Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 124 (31 Jul 2019)
Sequence version 1 (01 Mar 2001)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Methyltransferase-like protein 17, mitochondrial

Gene

METTL17

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be a component of the mitochondrial small ribosomal subunit.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionMethyltransferase, Ribonucleoprotein, Ribosomal protein, Transferase

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Methyltransferase-like protein 17, mitochondrial (EC:2.1.1.-)
Alternative name(s):
False p73 target gene protein
Methyltransferase 11 domain-containing protein 1
Protein RSM22 homolog, mitochondrial
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:METTL17
Synonyms:METT11D1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:19280 METTL17

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
616091 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9H7H0

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Mitochondrion

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
64745

Open Targets

More...
OpenTargetsi
ENSG00000165792

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA145008140

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
METTL17

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74718673

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a transit peptide.<p><a href='/help/transit' target='_top'>More...</a></p>Transit peptidei1 – 19MitochondrionSequence analysisAdd BLAST19
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000031216320 – 456Methyltransferase-like protein 17, mitochondrialAdd BLAST437

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9H7H0

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9H7H0

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9H7H0

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9H7H0

PeptideAtlas

More...
PeptideAtlasi
Q9H7H0

PRoteomics IDEntifications database

More...
PRIDEi
Q9H7H0

ProteomicsDB human proteome resource

More...
ProteomicsDBi
81121 [Q9H7H0-1]
81122 [Q9H7H0-2]
81123 [Q9H7H0-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9H7H0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9H7H0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000165792 Expressed in 212 organ(s), highest expression level in left lobe of thyroid gland

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9H7H0 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9H7H0 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA002955
HPA059802

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
122261, 41 interactors

Protein interaction database and analysis system

More...
IntActi
Q9H7H0, 27 interactors

Molecular INTeraction database

More...
MINTi
Q9H7H0

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000372445

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9H7H0

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transit peptide

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2539 Eukaryota
COG5459 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000006103

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9H7H0

Identification of Orthologs from Complete Genome Data

More...
OMAi
DRTPCNF

Database of Orthologous Groups

More...
OrthoDBi
1439584at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9H7H0

TreeFam database of animal gene trees

More...
TreeFami
TF313708

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR015324 Ribosomal_Rsm22-like
IPR029063 SAM-dependent_MTases

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF09243 Rsm22, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF53335 SSF53335, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9H7H0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAALKCLLT LGRWCPGLGV APQARALAAL VPGVTQVDNK SGFLQKRPHR
60 70 80 90 100
QHPGILKLPH VRLPQALANG AQLLLLGSAG PTMENQVQTL TSYLWSRHLP
110 120 130 140 150
VEPEELQRRA RHLEKKFLEN PDLSQTEEKL RGAVLHALRK TTYHWQELSY
160 170 180 190 200
TEGLSLVYMA ARLDGGFAAV SRAFHEIRAR NPAFQPQTLM DFGSGTGSVT
210 220 230 240 250
WAAHSIWGQS LREYMCVDRS AAMLVLAEKL LKGGSESGEP YIPGVFFRQF
260 270 280 290 300
LPVSPKVQFD VVVSAFSLSE LPSKADRTEV VQTLWRKTGH FLVLVENGTK
310 320 330 340 350
AGHSLLMDAR DLVLKGKEKS PLDPRPGFVF APCPHELPCP QLTNLACSFS
360 370 380 390 400
QAYHPIPFSW NKKPKEEKFS MVILARGSPE EAHRWPRITQ PVLKRPRHVH
410 420 430 440 450
CHLCCPDGHM QHAVLTARRH GRDLYRCARV SSWGDLLPVL TPSAFPPSTA

QDPSES
Length:456
Mass (Da):50,734
Last modified:March 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA23E9EF33C4BD3A1
GO
Isoform 2 (identifier: Q9H7H0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     422-430: Missing.

Note: No experimental confirmation available.
Show »
Length:447
Mass (Da):49,600
Checksum:iC96AB962BFA9A69D
GO
Isoform 3 (identifier: Q9H7H0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     423-456: DLYRCARVSSWGDLLPVLTPSAFPPSTAQDPSES → YGGCDQNQWD...VSSIYGSGSL

Show »
Length:478
Mass (Da):53,051
Checksum:i014BF85E346BF3F4
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G3V353G3V353_HUMAN
Methyltransferase-like protein 17, ...
METTL17
174Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V3X6G3V3X6_HUMAN
Methyltransferase-like protein 17, ...
METTL17
140Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YJW1H0YJW1_HUMAN
Methyltransferase-like protein 17, ...
METTL17
123Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B4E298B4E298_HUMAN
Methyltransferase like 17 isoform 2
METTL17
158Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V4P2G3V4P2_HUMAN
Methyltransferase-like protein 17, ...
METTL17
102Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V4H5G3V4H5_HUMAN
Methyltransferase-like protein 17, ...
METTL17
186Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti53P → S in AAK08200 (Ref. 1) Curated1
Sequence conflicti318E → G in AAK08200 (Ref. 1) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_072388173A → S1 PublicationCorresponds to variant dbSNP:rs72661115Ensembl.1
Natural variantiVAR_037422289G → A. Corresponds to variant dbSNP:rs2297717Ensembl.1
Natural variantiVAR_037423346A → P1 PublicationCorresponds to variant dbSNP:rs2771350Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_029720422 – 430Missing in isoform 2. 1 Publication9
Alternative sequenceiVSP_029721423 – 456DLYRC…DPSES → YGGCDQNQWDVAGSCSPRQH LFPQGFVSLCPCQLLGRSFT CAYSVCVSSIYGSGSL in isoform 3. 1 PublicationAdd BLAST34

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF321002 mRNA Translation: AAK08200.1
AF321003 Genomic DNA Translation: AAK08201.1
AK024512 mRNA Translation: BAB14919.1
CH471078 Genomic DNA Translation: EAW66433.1
CH471078 Genomic DNA Translation: EAW66434.1
BC005053 mRNA Translation: AAH05053.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS41913.1 [Q9H7H0-3]
CCDS9562.1 [Q9H7H0-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001025162.1, NM_001029991.1 [Q9H7H0-3]
NP_073571.1, NM_022734.2 [Q9H7H0-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000339374; ENSP00000343041; ENSG00000165792 [Q9H7H0-1]
ENST00000382985; ENSP00000372445; ENSG00000165792 [Q9H7H0-3]
ENST00000556670; ENSP00000450794; ENSG00000165792 [Q9H7H0-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
64745

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:64745

UCSC genome browser

More...
UCSCi
uc001vym.5 human [Q9H7H0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF321002 mRNA Translation: AAK08200.1
AF321003 Genomic DNA Translation: AAK08201.1
AK024512 mRNA Translation: BAB14919.1
CH471078 Genomic DNA Translation: EAW66433.1
CH471078 Genomic DNA Translation: EAW66434.1
BC005053 mRNA Translation: AAH05053.1
CCDSiCCDS41913.1 [Q9H7H0-3]
CCDS9562.1 [Q9H7H0-1]
RefSeqiNP_001025162.1, NM_001029991.1 [Q9H7H0-3]
NP_073571.1, NM_022734.2 [Q9H7H0-1]

3D structure databases

SMRiQ9H7H0
ModBaseiSearch...

Protein-protein interaction databases

BioGridi122261, 41 interactors
IntActiQ9H7H0, 27 interactors
MINTiQ9H7H0
STRINGi9606.ENSP00000372445

PTM databases

iPTMnetiQ9H7H0
PhosphoSitePlusiQ9H7H0

Polymorphism and mutation databases

BioMutaiMETTL17
DMDMi74718673

Proteomic databases

EPDiQ9H7H0
jPOSTiQ9H7H0
MaxQBiQ9H7H0
PaxDbiQ9H7H0
PeptideAtlasiQ9H7H0
PRIDEiQ9H7H0
ProteomicsDBi81121 [Q9H7H0-1]
81122 [Q9H7H0-2]
81123 [Q9H7H0-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
64745
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000339374; ENSP00000343041; ENSG00000165792 [Q9H7H0-1]
ENST00000382985; ENSP00000372445; ENSG00000165792 [Q9H7H0-3]
ENST00000556670; ENSP00000450794; ENSG00000165792 [Q9H7H0-2]
GeneIDi64745
KEGGihsa:64745
UCSCiuc001vym.5 human [Q9H7H0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
64745
DisGeNETi64745

GeneCards: human genes, protein and diseases

More...
GeneCardsi
METTL17
HGNCiHGNC:19280 METTL17
HPAiHPA002955
HPA059802
MIMi616091 gene
neXtProtiNX_Q9H7H0
OpenTargetsiENSG00000165792
PharmGKBiPA145008140

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2539 Eukaryota
COG5459 LUCA
GeneTreeiENSGT00390000006103
InParanoidiQ9H7H0
OMAiDRTPCNF
OrthoDBi1439584at2759
PhylomeDBiQ9H7H0
TreeFamiTF313708

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
METTL17 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
64745

Protein Ontology

More...
PROi
PR:Q9H7H0

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000165792 Expressed in 212 organ(s), highest expression level in left lobe of thyroid gland
ExpressionAtlasiQ9H7H0 baseline and differential
GenevisibleiQ9H7H0 HS

Family and domain databases

InterProiView protein in InterPro
IPR015324 Ribosomal_Rsm22-like
IPR029063 SAM-dependent_MTases
PfamiView protein in Pfam
PF09243 Rsm22, 1 hit
SUPFAMiSSF53335 SSF53335, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMET17_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9H7H0
Secondary accession number(s): Q9BSH1, Q9BZH2, Q9BZH3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 4, 2007
Last sequence update: March 1, 2001
Last modified: July 31, 2019
This is version 124 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again