Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 181 (31 Jul 2019)
Sequence version 2 (04 Nov 2008)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Serine protease inhibitor Kazal-type 5

Gene

SPINK5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Serine protease inhibitor, probably important for the anti-inflammatory and/or antimicrobial protection of mucous epithelia. Contribute to the integrity and protective barrier function of the skin by regulating the activity of defense-activating and desquamation-involved proteases. Inhibits KLK5, it's major target, in a pH-dependent manner. Inhibits KLK7, KLK14 CASP14, and trypsin.3 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei46 – 47Reactive bondPROSITE-ProRule annotation2

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionProtease inhibitor, Serine protease inhibitor

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-6809371 Formation of the cornified envelope

SABIO-RK: Biochemical Reaction Kinetics Database

More...
SABIO-RKi
Q9NQ38

Protein family/group databases

MEROPS protease database

More...
MEROPSi
I01.013

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Serine protease inhibitor Kazal-type 5
Alternative name(s):
Lympho-epithelial Kazal-type-related inhibitor
Short name:
LEKTI
Cleaved into the following 2 chains:
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SPINK5
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:15464 SPINK5

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605010 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9NQ38

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Netherton syndrome (NETH)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal recessive congenital ichthyosis associated with hair shaft abnormalities and anomalies of the immune system. Typical features are ichthyosis linearis circumflexa, ichthyosiform erythroderma, trichorrhexis invaginata (bamboo hair), atopic dermatitis, and hayfever. High postnatal mortality is due to failure to thrive, infections and hypernatremic dehydration.
Related information in OMIM

Keywords - Diseasei

Hypotrichosis, Ichthyosis

Organism-specific databases

DisGeNET

More...
DisGeNETi
11005

MalaCards human disease database

More...
MalaCardsi
SPINK5
MIMi256500 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000133710

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
634 Netherton syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA37962

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SPINK5

Domain mapping of disease mutations (DMDM)

More...
DMDMi
212276440

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 22Sequence analysisAdd BLAST22
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001657223 – 1064Serine protease inhibitor Kazal-type 5Add BLAST1042
<p>This subsection of the ‘PTM / Processing’ section describes the position and length of an active peptide in the mature protein.<p><a href='/help/peptide' target='_top'>More...</a></p>PeptideiPRO_000001657323 – 77Hemofiltrate peptide HF6478Add BLAST55
PeptideiPRO_0000016574356 – 423Hemofiltrate peptide HF7665Add BLAST68

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi30 ↔ 66
Disulfide bondi44 ↔ 63
Disulfide bondi97 ↔ 133PROSITE-ProRule annotation
Disulfide bondi111 ↔ 130PROSITE-ProRule annotation
Disulfide bondi119 ↔ 151PROSITE-ProRule annotation
Disulfide bondi161 ↔ 197PROSITE-ProRule annotation
Disulfide bondi175 ↔ 194PROSITE-ProRule annotation
Disulfide bondi225 ↔ 261PROSITE-ProRule annotation
Disulfide bondi239 ↔ 258PROSITE-ProRule annotation
Disulfide bondi297 ↔ 333PROSITE-ProRule annotation
Disulfide bondi311 ↔ 330PROSITE-ProRule annotation
Disulfide bondi367 ↔ 403
Disulfide bondi381 ↔ 400
Disulfide bondi437 ↔ 473PROSITE-ProRule annotation
Disulfide bondi451 ↔ 470PROSITE-ProRule annotation
Disulfide bondi496 ↔ 532PROSITE-ProRule annotation
Disulfide bondi510 ↔ 529PROSITE-ProRule annotation
Disulfide bondi567 ↔ 603PROSITE-ProRule annotation
Disulfide bondi581 ↔ 600PROSITE-ProRule annotation
Disulfide bondi632 ↔ 668PROSITE-ProRule annotation
Disulfide bondi646 ↔ 665PROSITE-ProRule annotation
Disulfide bondi707 ↔ 743PROSITE-ProRule annotation
Disulfide bondi721 ↔ 740PROSITE-ProRule annotation
Disulfide bondi774 ↔ 810PROSITE-ProRule annotation
Disulfide bondi788 ↔ 807PROSITE-ProRule annotation
Disulfide bondi849 ↔ 885PROSITE-ProRule annotation
Disulfide bondi863 ↔ 882PROSITE-ProRule annotation
Disulfide bondi916 ↔ 952PROSITE-ProRule annotation
Disulfide bondi930 ↔ 949PROSITE-ProRule annotation
Disulfide bondi993 ↔ 1028
Disulfide bondi1006 ↔ 1025
Disulfide bondi1014 ↔ 1046

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Proteolytically processed by furin in individual domains (D1, D5, D6, D8 through D11, and D9 through D15) exhibiting various inhibitory potentials for multiple proteases.1 Publication

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9NQ38

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9NQ38

PeptideAtlas

More...
PeptideAtlasi
Q9NQ38

PRoteomics IDEntifications database

More...
PRIDEi
Q9NQ38

ProteomicsDB human proteome resource

More...
ProteomicsDBi
82074 [Q9NQ38-1]
82075 [Q9NQ38-2]
82076 [Q9NQ38-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9NQ38

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9NQ38

Miscellaneous databases

CutDB - Proteolytic event database

More...
PMAP-CutDBi
Q9NQ38

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in the thymus and stratum corneum. Also found in the oral mucosa, parathyroid gland, Bartholin's glands, tonsils, and vaginal epithelium. Very low levels are detected in lung, kidney, and prostate.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000133710 Expressed in 130 organ(s), highest expression level in mouth mucosa

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9NQ38 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9NQ38 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB015347
HPA009067
HPA011351

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116196, 3 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000352936

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11064
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9NQ38

Database of comparative protein structure models

More...
ModBasei
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9NQ38

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini28 – 66Kazal-like 1; atypicalPROSITE-ProRule annotationAdd BLAST39
Domaini91 – 153Kazal-like 2PROSITE-ProRule annotationAdd BLAST63
Domaini155 – 216Kazal-like 3PROSITE-ProRule annotationAdd BLAST62
Domaini219 – 285Kazal-like 4PROSITE-ProRule annotationAdd BLAST67
Domaini291 – 352Kazal-like 5PROSITE-ProRule annotationAdd BLAST62
Domaini361 – 423Kazal-like 6PROSITE-ProRule annotationAdd BLAST63
Domaini431 – 489Kazal-like 7PROSITE-ProRule annotationAdd BLAST59
Domaini490 – 551Kazal-like 8PROSITE-ProRule annotationAdd BLAST62
Domaini561 – 622Kazal-like 9PROSITE-ProRule annotationAdd BLAST62
Domaini626 – 688Kazal-like 10PROSITE-ProRule annotationAdd BLAST63
Domaini701 – 757Kazal-like 11PROSITE-ProRule annotationAdd BLAST57
Domaini768 – 830Kazal-like 12PROSITE-ProRule annotationAdd BLAST63
Domaini843 – 905Kazal-like 13PROSITE-ProRule annotationAdd BLAST63
Domaini910 – 971Kazal-like 14PROSITE-ProRule annotationAdd BLAST62
Domaini987 – 1048Kazal-like 15PROSITE-ProRule annotationAdd BLAST62

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Contains at least one active inhibitory domain for trypsin (domain 6).

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IP0D Eukaryota
ENOG4111TR7 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00510000048608

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9NQ38

KEGG Orthology (KO)

More...
KOi
K23420

Identification of Orthologs from Complete Genome Data

More...
OMAi
MHVNKCA

Database of Orthologous Groups

More...
OrthoDBi
1283825at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9NQ38

TreeFam database of animal gene trees

More...
TreeFami
TF336724

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002350 Kazal_dom
IPR036058 Kazal_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00050 Kazal_1, 11 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00280 KAZAL, 14 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF100895 SSF100895, 15 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00282 KAZAL_1, 2 hits
PS51465 KAZAL_2, 14 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform f-l (identifier: Q9NQ38-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKIATVSVLL PLALCLIQDA ASKNEDQEMC HEFQAFMKNG KLFCPQDKKF
60 70 80 90 100
FQSLDGIMFI NKCATCKMIL EKEAKSQKRA RHLARAPKAT APTELNCDDF
110 120 130 140 150
KKGERDGDFI CPDYYEAVCG TDGKTYDNRC ALCAENAKTG SQIGVKSEGE
160 170 180 190 200
CKSSNPEQDV CSAFRPFVRD GRLGCTREND PVLGPDGKTH GNKCAMCAEL
210 220 230 240 250
FLKEAENAKR EGETRIRRNA EKDFCKEYEK QVRNGRLFCT RESDPVRGPD
260 270 280 290 300
GRMHGNKCAL CAEIFKQRFS EENSKTDQNL GKAEEKTKVK REIVKLCSQY
310 320 330 340 350
QNQAKNGILF CTRENDPIRG PDGKMHGNLC SMCQAYFQAE NEEKKKAEAR
360 370 380 390 400
ARNKRESGKA TSYAELCSEY RKLVRNGKLA CTRENDPIQG PDGKVHGNTC
410 420 430 440 450
SMCEVFFQAE EEEKKKKEGK SRNKRQSKST ASFEELCSEY RKSRKNGRLF
460 470 480 490 500
CTRENDPIQG PDGKMHGNTC SMCEAFFQQE ERARAKAKRE AAKEICSEFR
510 520 530 540 550
DQVRNGTLIC TREHNPVRGP DGKMHGNKCA MCASVFKLEE EEKKNDKEEK
560 570 580 590 600
GKVEAEKVKR EAVQELCSEY RHYVRNGRLP CTRENDPIEG LDGKIHGNTC
610 620 630 640 650
SMCEAFFQQE AKEKERAEPR AKVKREAEKE TCDEFRRLLQ NGKLFCTREN
660 670 680 690 700
DPVRGPDGKT HGNKCAMCKA VFQKENEERK RKEEEDQRNA AGHGSSGGGG
710 720 730 740 750
GNTQDECAEY REQMKNGRLS CTRESDPVRD ADGKSYNNQC TMCKAKLERE
760 770 780 790 800
AERKNEYSRS RSNGTGSESG KDTCDEFRSQ MKNGKLICTR ESDPVRGPDG
810 820 830 840 850
KTHGNKCTMC KEKLEREAAE KKKKEDEDRS NTGERSNTGE RSNDKEDLCR
860 870 880 890 900
EFRSMQRNGK LICTRENNPV RGPYGKMHIN KCAMCQSIFD REANERKKKD
910 920 930 940 950
EEKSSSKPSN NAKDECSEFR NYIRNNELIC PRENDPVHGA DGKFYTNKCY
960 970 980 990 1000
MCRAVFLTEA LERAKLQEKP SHVRASQEED SPDSFSSLDS EMCKDYRVLP
1010 1020 1030 1040 1050
RIGYLCPKDL KPVCGDDGQT YNNPCMLCHE NLIRQTNTHI RSTGKCEESS
1060
TPGTTAASMP PSDE
Length:1,064
Mass (Da):120,714
Last modified:November 4, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6CBEF39BB9E6D75D
GO
Isoform short (identifier: Q9NQ38-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     914-916: DEC → VIY
     917-1064: Missing.

Show »
Length:916
Mass (Da):104,017
Checksum:i82A029D102BD8C26
GO
Isoform long (identifier: Q9NQ38-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     914-914: D → DQCRQVQNEAEDAKFRQPGRSLASVARMSTD

Show »
Length:1,094
Mass (Da):124,076
Checksum:i8EF0D8DE3A62227A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E7EWP9E7EWP9_HUMAN
Serine protease inhibitor Kazal-typ...
SPINK5
869Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RFU9E5RFU9_HUMAN
Serine protease inhibitor Kazal-typ...
SPINK5
201Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RG22E5RG22_HUMAN
Serine protease inhibitor Kazal-typ...
SPINK5
68Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti19 – 27DAASKNEDQ → GQCEKDSLS in CAB96877 (PubMed:10835624).Curated9

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_047115267Q → R3 PublicationsCorresponds to variant dbSNP:rs6892205EnsemblClinVar.1
Natural variantiVAR_061337335A → V2 PublicationsCorresponds to variant dbSNP:rs34482796EnsemblClinVar.1
Natural variantiVAR_047116368S → N3 PublicationsCorresponds to variant dbSNP:rs2303063EnsemblClinVar.1
Natural variantiVAR_047117386D → N. Corresponds to variant dbSNP:rs2303064EnsemblClinVar.1
Natural variantiVAR_047118395V → M. Corresponds to variant dbSNP:rs17775319Ensembl.1
Natural variantiVAR_015537420K → E3 PublicationsCorresponds to variant dbSNP:rs2303067EnsemblClinVar.1
Natural variantiVAR_047119441R → H. Corresponds to variant dbSNP:rs34393923EnsemblClinVar.1
Natural variantiVAR_047120588I → M. Corresponds to variant dbSNP:rs35877540EnsemblClinVar.1
Natural variantiVAR_047121711R → Q2 PublicationsCorresponds to variant dbSNP:rs3777134EnsemblClinVar.1
Natural variantiVAR_047122825E → D. Corresponds to variant dbSNP:rs2303070EnsemblClinVar.1
Natural variantiVAR_047123887S → R. Corresponds to variant dbSNP:rs28408445EnsemblClinVar.1
Natural variantiVAR_047124969K → E. Corresponds to variant dbSNP:rs3188691EnsemblClinVar.1
Natural variantiVAR_047125972H → R. Corresponds to variant dbSNP:rs17705005EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_040019914 – 916DEC → VIY in isoform short. 1 Publication3
Alternative sequenceiVSP_040020914D → DQCRQVQNEAEDAKFRQPGR SLASVARMSTD in isoform long. 1 Publication1
Alternative sequenceiVSP_040021917 – 1064Missing in isoform short. 1 PublicationAdd BLAST148

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ228139 mRNA Translation: CAB40839.1
AJ391230
, AJ270944, AJ391231, AJ391232, AJ391233, AJ391234, AJ391235, AJ276579, AJ391236, AJ276580, AJ391237, AJ391238, AJ391239, AJ391240, AJ391241, AJ276578, AJ391242, AJ391243, AJ391244, AJ391245, AJ391246, AJ391247, AJ391248, AJ391249, AJ391250, AJ391251, AJ391252, AJ391253, AJ391254, AJ276577 Genomic DNA Translation: CAB96877.1
DQ149927 mRNA Translation: ABA06534.1
DQ149928 mRNA Translation: ABA06535.1
DQ149929 mRNA Translation: ABA06536.1
AC008722 Genomic DNA No translation available.
AC116334 Genomic DNA No translation available.
AF295784 Genomic DNA Translation: AAK97139.1
AF295783 Genomic DNA Translation: AAK97140.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS43382.1 [Q9NQ38-1]
CCDS47300.1 [Q9NQ38-3]
CCDS47301.1 [Q9NQ38-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001121170.1, NM_001127698.1 [Q9NQ38-3]
NP_001121171.1, NM_001127699.1 [Q9NQ38-2]
NP_006837.2, NM_006846.3 [Q9NQ38-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000256084; ENSP00000256084; ENSG00000133710 [Q9NQ38-1]
ENST00000359874; ENSP00000352936; ENSG00000133710 [Q9NQ38-3]
ENST00000398454; ENSP00000381472; ENSG00000133710 [Q9NQ38-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
11005

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:11005

UCSC genome browser

More...
UCSCi
uc003low.2 human [Q9NQ38-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

SPINK5base

SPINK5 mutation db

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ228139 mRNA Translation: CAB40839.1
AJ391230
, AJ270944, AJ391231, AJ391232, AJ391233, AJ391234, AJ391235, AJ276579, AJ391236, AJ276580, AJ391237, AJ391238, AJ391239, AJ391240, AJ391241, AJ276578, AJ391242, AJ391243, AJ391244, AJ391245, AJ391246, AJ391247, AJ391248, AJ391249, AJ391250, AJ391251, AJ391252, AJ391253, AJ391254, AJ276577 Genomic DNA Translation: CAB96877.1
DQ149927 mRNA Translation: ABA06534.1
DQ149928 mRNA Translation: ABA06535.1
DQ149929 mRNA Translation: ABA06536.1
AC008722 Genomic DNA No translation available.
AC116334 Genomic DNA No translation available.
AF295784 Genomic DNA Translation: AAK97139.1
AF295783 Genomic DNA Translation: AAK97140.1
CCDSiCCDS43382.1 [Q9NQ38-1]
CCDS47300.1 [Q9NQ38-3]
CCDS47301.1 [Q9NQ38-2]
RefSeqiNP_001121170.1, NM_001127698.1 [Q9NQ38-3]
NP_001121171.1, NM_001127699.1 [Q9NQ38-2]
NP_006837.2, NM_006846.3 [Q9NQ38-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1H0ZNMR-A356-423[»]
1HDLNMR-A23-77[»]
1UUCNMR-A23-77[»]
1UVFNMR-A989-1047[»]
1UVGNMR-A989-1064[»]
5YHNNMR-A220-288[»]
SMRiQ9NQ38
ModBaseiSearch...

Protein-protein interaction databases

BioGridi116196, 3 interactors
STRINGi9606.ENSP00000352936

Protein family/group databases

MEROPSiI01.013

PTM databases

iPTMnetiQ9NQ38
PhosphoSitePlusiQ9NQ38

Polymorphism and mutation databases

BioMutaiSPINK5
DMDMi212276440

Proteomic databases

jPOSTiQ9NQ38
PaxDbiQ9NQ38
PeptideAtlasiQ9NQ38
PRIDEiQ9NQ38
ProteomicsDBi82074 [Q9NQ38-1]
82075 [Q9NQ38-2]
82076 [Q9NQ38-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
11005
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000256084; ENSP00000256084; ENSG00000133710 [Q9NQ38-1]
ENST00000359874; ENSP00000352936; ENSG00000133710 [Q9NQ38-3]
ENST00000398454; ENSP00000381472; ENSG00000133710 [Q9NQ38-2]
GeneIDi11005
KEGGihsa:11005
UCSCiuc003low.2 human [Q9NQ38-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
11005
DisGeNETi11005

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SPINK5
HGNCiHGNC:15464 SPINK5
HPAiCAB015347
HPA009067
HPA011351
MalaCardsiSPINK5
MIMi256500 phenotype
605010 gene
neXtProtiNX_Q9NQ38
OpenTargetsiENSG00000133710
Orphaneti634 Netherton syndrome
PharmGKBiPA37962

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IP0D Eukaryota
ENOG4111TR7 LUCA
GeneTreeiENSGT00510000048608
InParanoidiQ9NQ38
KOiK23420
OMAiMHVNKCA
OrthoDBi1283825at2759
PhylomeDBiQ9NQ38
TreeFamiTF336724

Enzyme and pathway databases

ReactomeiR-HSA-6809371 Formation of the cornified envelope
SABIO-RKiQ9NQ38

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SPINK5 human
EvolutionaryTraceiQ9NQ38

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
LEKTI

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
11005
PMAP-CutDBiQ9NQ38

Protein Ontology

More...
PROi
PR:Q9NQ38

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000133710 Expressed in 130 organ(s), highest expression level in mouth mucosa
ExpressionAtlasiQ9NQ38 baseline and differential
GenevisibleiQ9NQ38 HS

Family and domain databases

InterProiView protein in InterPro
IPR002350 Kazal_dom
IPR036058 Kazal_dom_sf
PfamiView protein in Pfam
PF00050 Kazal_1, 11 hits
SMARTiView protein in SMART
SM00280 KAZAL, 14 hits
SUPFAMiSSF100895 SSF100895, 15 hits
PROSITEiView protein in PROSITE
PS00282 KAZAL_1, 2 hits
PS51465 KAZAL_2, 14 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiISK5_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NQ38
Secondary accession number(s): A8MYE8
, B7WPB7, D6REN5, O75770, Q3LX95, Q3LX96, Q3LX97, Q96PP2, Q96PP3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 4, 2001
Last sequence update: November 4, 2008
Last modified: July 31, 2019
This is version 181 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again