Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 160 (08 May 2019)
Sequence version 3 (23 Jan 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Xaa-Pro aminopeptidase 1

Gene

XPNPEP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Contributes to the degradation of bradykinin. Catalyzes the removal of a penultimate prolyl residue from the N-termini of peptides, such as Arg-Pro-Pro.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • Release of any N-terminal amino acid, including proline, that is linked to proline, even from a dipeptide or tripeptide.2 Publications EC:3.4.11.9

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mn2+2 PublicationsNote: Binds 2 manganese ions per subunit.2 Publications

<p>This subsection of the ‘Function’ section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by apstatin and the metal ion chelators EDTA and 1,10-phenanthroline. Partially inhibited by dithiothreitol. Not inhibited by enalaprilat or amastatin.1 Publication

<p>This subsection of the ‘Function’ section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=100.6 µM for bradykinin2 Publications
  2. KM=308 µM for the tripeptide Arg-Pro-Pro2 Publications

    pH dependencei

    Optimum pH is 8.2.2 Publications

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei77SubstrateBy similarity1
    Binding sitei395Substrate; via tele nitrogenBy similarity1
    <p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi415Manganese 1Combined sources1 Publication1
    Metal bindingi426Manganese 1Combined sources1 Publication1
    Metal bindingi426Manganese 2Combined sources1 Publication1
    Metal bindingi489Manganese 2; via tele nitrogenCombined sources1 Publication1
    Binding sitei489Substrate; via tele nitrogenBy similarity1
    Binding sitei498Substrate; via tele nitrogenBy similarity1
    Metal bindingi523Manganese 2Combined sources1 Publication1
    Binding sitei523SubstrateBy similarity1
    Metal bindingi537Manganese 1Combined sources1 Publication1
    Metal bindingi537Manganese 2Combined sources1 Publication1

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    GO - Biological processi

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionAminopeptidase, Hydrolase, Metalloprotease, Protease
    LigandManganese, Metal-binding

    Enzyme and pathway databases

    BRENDA Comprehensive Enzyme Information System

    More...
    BRENDAi
    3.1.8.1 2681
    3.4.11.9 2681

    Protein family/group databases

    MEROPS protease database

    More...
    MEROPSi
    M24.009

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Xaa-Pro aminopeptidase 1 (EC:3.4.11.9)
    Alternative name(s):
    Aminoacylproline aminopeptidase
    Cytosolic aminopeptidase P
    Soluble aminopeptidase P
    Short name:
    sAmp
    X-Pro aminopeptidase 1
    X-prolyl aminopeptidase 1, soluble
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:XPNPEP1Imported
    Synonyms:XPNPEPLImported, XPNPEPL1
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

    Organism-specific databases

    Human Gene Nomenclature Database

    More...
    HGNCi
    HGNC:12822 XPNPEP1

    Online Mendelian Inheritance in Man (OMIM)

    More...
    MIMi
    602443 gene

    neXtProt; the human protein knowledge platform

    More...
    neXtProti
    NX_Q9NQW7

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

    Keywords - Cellular componenti

    Cytoplasm

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi41E → A: Reduces activity by 10%. 1 Publication1
    Mutagenesisi477W → E: Interferes with dimerization and reduces activity by 94%. 1 Publication1

    Organism-specific databases

    DisGeNET

    More...
    DisGeNETi
    7511

    Open Targets

    More...
    OpenTargetsi
    ENSG00000108039

    The Pharmacogenetics and Pharmacogenomics Knowledge Base

    More...
    PharmGKBi
    PA37415

    Chemistry databases

    ChEMBL database of bioactive drug-like small molecules

    More...
    ChEMBLi
    CHEMBL3782

    IUPHAR/BPS Guide to PHARMACOLOGY

    More...
    GuidetoPHARMACOLOGYi
    1578

    Polymorphism and mutation databases

    BioMuta curated single-nucleotide variation and disease association database

    More...
    BioMutai
    XPNPEP1

    Domain mapping of disease mutations (DMDM)

    More...
    DMDMi
    68566146

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemoved1 Publication
    <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001850832 – 623Xaa-Pro aminopeptidase 1Add BLAST622

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei304N6-acetyllysineCombined sources1

    Keywords - PTMi

    Acetylation

    Proteomic databases

    Encyclopedia of Proteome Dynamics

    More...
    EPDi
    Q9NQW7

    jPOST - Japan Proteome Standard Repository/Database

    More...
    jPOSTi
    Q9NQW7

    MaxQB - The MaxQuant DataBase

    More...
    MaxQBi
    Q9NQW7

    PaxDb, a database of protein abundance averages across all three domains of life

    More...
    PaxDbi
    Q9NQW7

    PeptideAtlas

    More...
    PeptideAtlasi
    Q9NQW7

    PRoteomics IDEntifications database

    More...
    PRIDEi
    Q9NQW7

    ProteomicsDB human proteome resource

    More...
    ProteomicsDBi
    82211
    82212 [Q9NQW7-2]

    PTM databases

    iPTMnet integrated resource for PTMs in systems biology context

    More...
    iPTMneti
    Q9NQW7

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...
    PhosphoSitePlusi
    Q9NQW7

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    <p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

    Expressed in all tissues tested, including pancreas, heart, muscle, kidney, liver, lung and brain. Highest levels in pancreas.1 Publication

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...
    Bgeei
    ENSG00000108039 Expressed in 231 organ(s), highest expression level in body of pancreas

    ExpressionAtlas, Differential and Baseline Expression

    More...
    ExpressionAtlasi
    Q9NQW7 baseline and differential

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...
    Genevisiblei
    Q9NQW7 HS

    Organism-specific databases

    Human Protein Atlas

    More...
    HPAi
    CAB025196
    HPA030419
    HPA030420
    HPA030422

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    <p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

    Homodimer.2 Publications

    GO - Molecular functioni

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGrid)

    More...
    BioGridi
    113346, 79 interactors

    Protein interaction database and analysis system

    More...
    IntActi
    Q9NQW7, 11 interactors

    Molecular INTeraction database

    More...
    MINTi
    Q9NQW7

    STRING: functional protein association networks

    More...
    STRINGi
    9606.ENSP00000421566

    Chemistry databases

    BindingDB database of measured binding affinities

    More...
    BindingDBi
    Q9NQW7

    <p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

    Secondary structure

    1623
    Legend: HelixTurnBeta strandPDB Structure known for this area
    Show more details

    3D structure databases

    Select the link destinations:

    Protein Data Bank Europe

    More...
    PDBei

    Protein Data Bank RCSB

    More...
    RCSB PDBi

    Protein Data Bank Japan

    More...
    PDBji
    Links Updated
    PDB entryMethodResolution (Å)ChainPositionsPDBsum
    3CTZX-ray1.60A1-623[»]

    SWISS-MODEL Repository - a database of annotated 3D protein structure models

    More...
    SMRi
    Q9NQW7

    Database of comparative protein structure models

    More...
    ModBasei
    Search...

    MobiDB: a database of protein disorder and mobility annotations

    More...
    MobiDBi
    Search...

    Miscellaneous databases

    Relative evolutionary importance of amino acids within a protein sequence

    More...
    EvolutionaryTracei
    Q9NQW7

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    <p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Belongs to the peptidase M24B family.Sequence analysis

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...
    eggNOGi
    KOG2413 Eukaryota
    COG0006 LUCA

    Ensembl GeneTree

    More...
    GeneTreei
    ENSGT00940000157716

    The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

    More...
    HOGENOMi
    HOG000255713

    InParanoid: Eukaryotic Ortholog Groups

    More...
    InParanoidi
    Q9NQW7

    KEGG Orthology (KO)

    More...
    KOi
    K01262

    Identification of Orthologs from Complete Genome Data

    More...
    OMAi
    YRPGKWG

    Database of Orthologous Groups

    More...
    OrthoDBi
    417805at2759

    Database for complete collections of gene phylogenies

    More...
    PhylomeDBi
    Q9NQW7

    TreeFam database of animal gene trees

    More...
    TreeFami
    TF314183

    Family and domain databases

    Conserved Domains Database

    More...
    CDDi
    cd01085 APP, 1 hit

    Gene3D Structural and Functional Annotation of Protein Families

    More...
    Gene3Di
    3.40.350.10, 2 hits

    Integrated resource of protein families, domains and functional sites

    More...
    InterProi
    View protein in InterPro
    IPR029149 Creatin/AminoP/Spt16_NTD
    IPR036005 Creatinase/aminopeptidase-like
    IPR000587 Creatinase_N
    IPR000994 Pept_M24
    IPR033740 Pept_M24B
    IPR032416 Peptidase_M24_C
    IPR001131 Peptidase_M24B_aminopep-P_CS

    Pfam protein domain database

    More...
    Pfami
    View protein in Pfam
    PF01321 Creatinase_N, 1 hit
    PF00557 Peptidase_M24, 1 hit
    PF16188 Peptidase_M24_C, 1 hit

    Superfamily database of structural and functional annotation

    More...
    SUPFAMi
    SSF53092 SSF53092, 1 hit
    SSF55920 SSF55920, 1 hit

    PROSITE; a protein domain and family database

    More...
    PROSITEi
    View protein in PROSITE
    PS00491 PROLINE_PEPTIDASE, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

    This entry has 4 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

    Isoform 11 Publication (identifier: Q9NQW7-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MPPKVTSELL RQLRQAMRNS EYVTEPIQAY IIPSGDAHQS EYIAPCDCRR
    60 70 80 90 100
    AFVSGFDGSA GTAIITEEHA AMWTDGRYFL QAAKQMDSNW TLMKMGLKDT
    110 120 130 140 150
    PTQEDWLVSV LPEGSRVGVD PLIIPTDYWK KMAKVLRSAG HHLIPVKENL
    160 170 180 190 200
    VDKIWTDRPE RPCKPLLTLG LDYTGISWKD KVADLRLKMA ERNVMWFVVT
    210 220 230 240 250
    ALDEIAWLFN LRGSDVEHNP VFFSYAIIGL ETIMLFIDGD RIDAPSVKEH
    260 270 280 290 300
    LLLDLGLEAE YRIQVHPYKS ILSELKALCA DLSPREKVWV SDKASYAVSE
    310 320 330 340 350
    TIPKDHRCCM PYTPICIAKA VKNSAESEGM RRAHIKDAVA LCELFNWLEK
    360 370 380 390 400
    EVPKGGVTEI SAADKAEEFR RQQADFVDLS FPTISSTGPN GAIIHYAPVP
    410 420 430 440 450
    ETNRTLSLDE VYLIDSGAQY KDGTTDVTRT MHFGTPTAYE KECFTYVLKG
    460 470 480 490 500
    HIAVSAAVFP TGTKGHLLDS FARSALWDSG LDYLHGTGHG VGSFLNVHEG
    510 520 530 540 550
    PCGISYKTFS DEPLEAGMIV TDEPGYYEDG AFGIRIENVV LVVPVKTKYN
    560 570 580 590 600
    FNNRGSLTFE PLTLVPIQTK MIDVDSLTDK ECDWLNNYHL TCRDVIGKEL
    610 620
    QKQGRQEALE WLIRETQPIS KQH
    Length:623
    Mass (Da):69,918
    Last modified:January 23, 2007 - v3
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDF4F5AF41E2F3876
    GO
    Isoform 2 (identifier: Q9NQW7-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         398-421: Missing.

    Note: No experimental confirmation available.Curated
    Show »
    Length:599
    Mass (Da):67,227
    Checksum:i6F6A7D909E1CC84D
    GO
    Isoform 3 (identifier: Q9NQW7-3) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MAASRKPPRVRVNHQDFQLRNLRIIEPNEVTHSGDTGVETDGRM

    Note: No experimental confirmation available.
    Show »
    Length:666
    Mass (Da):74,798
    Checksum:i59D0596A49C93B17
    GO
    Isoform 4 (identifier: Q9NQW7-4) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MAASRKPPRVRVNHQDFQLRNLRIIEPNEVTHSGDTGVETDGRM
         398-421: Missing.

    Show »
    Length:642
    Mass (Da):72,107
    Checksum:i0119CDC61051D1C2
    GO

    <p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

    There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
    EntryEntry nameProtein names
    Gene namesLengthAnnotation
    Q5T6H7Q5T6H7_HUMAN
    Xaa-Pro aminopeptidase 1
    XPNPEP1
    552Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    Q5T6H2Q5T6H2_HUMAN
    Xaa-Pro aminopeptidase 1
    XPNPEP1
    303Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    Q5T6H3Q5T6H3_HUMAN
    Xaa-Pro aminopeptidase 1
    XPNPEP1
    233Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

    <p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

    The sequence CAD38640 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti90W → C in AAH13417 (PubMed:15489334).Curated1
    Sequence conflicti131K → R in BAF82125 (PubMed:14702039).Curated1
    Sequence conflicti332R → P in CAA65068 (PubMed:9465902).Curated1
    Sequence conflicti332R → P in AAF97866 (PubMed:10871044).Curated1
    Sequence conflicti496N → D in BAD97233 (PubMed:17974005).Curated1
    Sequence conflicti498H → R in BAD97233 (PubMed:17974005).Curated1
    Sequence conflicti572I → T in BAF82125 (PubMed:14702039).Curated1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0452501M → MAASRKPPRVRVNHQDFQLR NLRIIEPNEVTHSGDTGVET DGRM in isoform 3 and isoform 4. 1 Publication1
    Alternative sequenceiVSP_051752398 – 421Missing in isoform 2 and isoform 4. 1 PublicationAdd BLAST24

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...
    EMBLi

    GenBank nucleotide sequence database

    More...
    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...
    DDBJi
    Links Updated
    X95762 mRNA Translation: CAA65068.1
    AF195530 mRNA Translation: AAF97866.1
    AF272981 mRNA Translation: AAF75795.1
    AK289436 mRNA Translation: BAF82125.1
    CR456922 mRNA Translation: CAG33203.1
    AK223513 mRNA Translation: BAD97233.1
    AL833411 mRNA Translation: CAD38640.1 Different initiation.
    AL354951 Genomic DNA No translation available.
    CH471066 Genomic DNA Translation: EAW49577.1
    BC005126 mRNA Translation: AAH05126.1
    BC007579 mRNA Translation: AAH07579.1
    BC013417 mRNA Translation: AAH13417.4

    The Consensus CDS (CCDS) project

    More...
    CCDSi
    CCDS53576.1 [Q9NQW7-4]
    CCDS7560.2 [Q9NQW7-3]

    NCBI Reference Sequences

    More...
    RefSeqi
    NP_001161076.1, NM_001167604.1 [Q9NQW7-4]
    NP_001311061.1, NM_001324132.1 [Q9NQW7-1]
    NP_065116.3, NM_020383.3 [Q9NQW7-3]

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...
    Ensembli
    ENST00000322238; ENSP00000324011; ENSG00000108039 [Q9NQW7-4]
    ENST00000502935; ENSP00000421566; ENSG00000108039 [Q9NQW7-3]

    Database of genes from NCBI RefSeq genomes

    More...
    GeneIDi
    7511

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...
    KEGGi
    hsa:7511

    UCSC genome browser

    More...
    UCSCi
    uc001kyp.2 human [Q9NQW7-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    X95762 mRNA Translation: CAA65068.1
    AF195530 mRNA Translation: AAF97866.1
    AF272981 mRNA Translation: AAF75795.1
    AK289436 mRNA Translation: BAF82125.1
    CR456922 mRNA Translation: CAG33203.1
    AK223513 mRNA Translation: BAD97233.1
    AL833411 mRNA Translation: CAD38640.1 Different initiation.
    AL354951 Genomic DNA No translation available.
    CH471066 Genomic DNA Translation: EAW49577.1
    BC005126 mRNA Translation: AAH05126.1
    BC007579 mRNA Translation: AAH07579.1
    BC013417 mRNA Translation: AAH13417.4
    CCDSiCCDS53576.1 [Q9NQW7-4]
    CCDS7560.2 [Q9NQW7-3]
    RefSeqiNP_001161076.1, NM_001167604.1 [Q9NQW7-4]
    NP_001311061.1, NM_001324132.1 [Q9NQW7-1]
    NP_065116.3, NM_020383.3 [Q9NQW7-3]

    3D structure databases

    Select the link destinations:
    PDBei
    RCSB PDBi
    PDBji
    Links Updated
    PDB entryMethodResolution (Å)ChainPositionsPDBsum
    3CTZX-ray1.60A1-623[»]
    SMRiQ9NQW7
    ModBaseiSearch...
    MobiDBiSearch...

    Protein-protein interaction databases

    BioGridi113346, 79 interactors
    IntActiQ9NQW7, 11 interactors
    MINTiQ9NQW7
    STRINGi9606.ENSP00000421566

    Chemistry databases

    BindingDBiQ9NQW7
    ChEMBLiCHEMBL3782
    GuidetoPHARMACOLOGYi1578

    Protein family/group databases

    MEROPSiM24.009

    PTM databases

    iPTMnetiQ9NQW7
    PhosphoSitePlusiQ9NQW7

    Polymorphism and mutation databases

    BioMutaiXPNPEP1
    DMDMi68566146

    Proteomic databases

    EPDiQ9NQW7
    jPOSTiQ9NQW7
    MaxQBiQ9NQW7
    PaxDbiQ9NQW7
    PeptideAtlasiQ9NQW7
    PRIDEiQ9NQW7
    ProteomicsDBi82211
    82212 [Q9NQW7-2]

    Protocols and materials databases

    The DNASU plasmid repository

    More...
    DNASUi
    7511
    Structural Biology KnowledgebaseSearch...

    Genome annotation databases

    EnsembliENST00000322238; ENSP00000324011; ENSG00000108039 [Q9NQW7-4]
    ENST00000502935; ENSP00000421566; ENSG00000108039 [Q9NQW7-3]
    GeneIDi7511
    KEGGihsa:7511
    UCSCiuc001kyp.2 human [Q9NQW7-1]

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...
    CTDi
    7511
    DisGeNETi7511

    GeneCards: human genes, protein and diseases

    More...
    GeneCardsi
    XPNPEP1
    HGNCiHGNC:12822 XPNPEP1
    HPAiCAB025196
    HPA030419
    HPA030420
    HPA030422
    MIMi602443 gene
    neXtProtiNX_Q9NQW7
    OpenTargetsiENSG00000108039
    PharmGKBiPA37415

    GenAtlas: human gene database

    More...
    GenAtlasi
    Search...

    Phylogenomic databases

    eggNOGiKOG2413 Eukaryota
    COG0006 LUCA
    GeneTreeiENSGT00940000157716
    HOGENOMiHOG000255713
    InParanoidiQ9NQW7
    KOiK01262
    OMAiYRPGKWG
    OrthoDBi417805at2759
    PhylomeDBiQ9NQW7
    TreeFamiTF314183

    Enzyme and pathway databases

    BRENDAi3.1.8.1 2681
    3.4.11.9 2681

    Miscellaneous databases

    ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

    More...
    ChiTaRSi
    XPNPEP1 human
    EvolutionaryTraceiQ9NQW7

    The Gene Wiki collection of pages on human genes and proteins

    More...
    GeneWikii
    XPNPEP1

    Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

    More...
    GenomeRNAii
    7511

    Protein Ontology

    More...
    PROi
    PR:Q9NQW7

    The Stanford Online Universal Resource for Clones and ESTs

    More...
    SOURCEi
    Search...

    Gene expression databases

    BgeeiENSG00000108039 Expressed in 231 organ(s), highest expression level in body of pancreas
    ExpressionAtlasiQ9NQW7 baseline and differential
    GenevisibleiQ9NQW7 HS

    Family and domain databases

    CDDicd01085 APP, 1 hit
    Gene3Di3.40.350.10, 2 hits
    InterProiView protein in InterPro
    IPR029149 Creatin/AminoP/Spt16_NTD
    IPR036005 Creatinase/aminopeptidase-like
    IPR000587 Creatinase_N
    IPR000994 Pept_M24
    IPR033740 Pept_M24B
    IPR032416 Peptidase_M24_C
    IPR001131 Peptidase_M24B_aminopep-P_CS
    PfamiView protein in Pfam
    PF01321 Creatinase_N, 1 hit
    PF00557 Peptidase_M24, 1 hit
    PF16188 Peptidase_M24_C, 1 hit
    SUPFAMiSSF53092 SSF53092, 1 hit
    SSF55920 SSF55920, 1 hit
    PROSITEiView protein in PROSITE
    PS00491 PROLINE_PEPTIDASE, 1 hit

    ProtoNet; Automatic hierarchical classification of proteins

    More...
    ProtoNeti
    Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiXPP1_HUMAN
    <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NQW7
    Secondary accession number(s): A8K071
    , G5E9Y2, G8JLB2, O15250, Q53EX6, Q8N3Q0, Q96D23
    <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 5, 2005
    Last sequence update: January 23, 2007
    Last modified: May 8, 2019
    This is version 160 of the entry and version 3 of the sequence. See complete history.
    <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    <p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 10
      Human chromosome 10: entries, gene names and cross-references to MIM
    2. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    3. SIMILARITY comments
      Index of protein domains and families
    4. Peptidase families
      Classification of peptidase families and list of entries
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again