Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 149 (18 Sep 2019)
Sequence version 3 (14 Dec 2011)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Double zinc ribbon and ankyrin repeat-containing protein 1

Gene

DZANK1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri211 – 270DZANK-type 1Add BLAST60
Zinc fingeri339 – 387DZANK-type 2Add BLAST49

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Double zinc ribbon and ankyrin repeat-containing protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:DZANK1
Synonyms:C20orf12, C20orf84
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 20

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:15858 DZANK1

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9NVP4

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000089091

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA25660

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
DZANK1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
363548518

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000669861 – 752Double zinc ribbon and ankyrin repeat-containing protein 1Add BLAST752

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei160PhosphoserineBy similarity1
Modified residuei182PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9NVP4

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9NVP4

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9NVP4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9NVP4

PeptideAtlas

More...
PeptideAtlasi
Q9NVP4

PRoteomics IDEntifications database

More...
PRIDEi
Q9NVP4

ProteomicsDB human proteome resource

More...
ProteomicsDBi
82839 [Q9NVP4-1]
82840 [Q9NVP4-2]
82841 [Q9NVP4-3]
82842 [Q9NVP4-4]
82843 [Q9NVP4-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9NVP4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9NVP4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000089091 Expressed in 156 organ(s), highest expression level in oviduct epithelium

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9NVP4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9NVP4 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA059478
HPA064255

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
120483, 5 interactors

Protein interaction database and analysis system

More...
IntActi
Q9NVP4, 3 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000262547

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9NVP4

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati605 – 636ANK 1Add BLAST32
Repeati640 – 669ANK 2Add BLAST30

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri211 – 270DZANK-type 1Add BLAST60
Zinc fingeri339 – 387DZANK-type 2Add BLAST49

Keywords - Domaini

ANK repeat, Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IEZB Eukaryota
ENOG410XPI2 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000000549

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9NVP4

Identification of Orthologs from Complete Genome Data

More...
OMAi
PMNTPTC

Database of Orthologous Groups

More...
OrthoDBi
391157at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9NVP4

TreeFam database of animal gene trees

More...
TreeFami
TF351270

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.40.20, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR025874 DZR
IPR026876 Fn3_assoc_repeat

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12773 DZR, 1 hit
PF13287 Fn3_assoc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48403 SSF48403, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9NVP4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTAGSVCVPQ IIPLRVPQPG KANHEIDNNT LLEMKSDTPD VNIYYTLDGS
60 70 80 90 100
KPEFLKRIGY GENNTFKYIK PITLPDGKIQ VKAIAVSKDC RQSGIVTKVF
110 120 130 140 150
HVDYEPPNIV SPEDNVENVL KDSSRQEFKN GFVGSKLKKK YKNSENQRSW
160 170 180 190 200
NVNLRKFPES PLEIPAYGGG SGSRPPTRQS QSPGFAHVSG QKCLTSTEIM
210 220 230 240 250
RIQRETDFLK CAHCLAPRPS DPFARFCQEC GSPVPPIFGC RLPPPEGAQM
260 270 280 290 300
GLCAECRSLV PMNTPICVVC EAPLALQLQP QASLHLKEKV ICRACGTGNP
310 320 330 340 350
AHLRYCVTCE GALPSSQESM CSGDKAPPPP TQKGGTISCY RCGRWNLWEA
360 370 380 390 400
SFCGWCGAML GIPAGCSVCP KCGASNHLSA RFCGSCGICV KSLVKLSLDR
410 420 430 440 450
SLALAAEEPR PFSESLNIPL PRSDVGTKRD IGTQTVGLFY PSGKLLAKKE
460 470 480 490 500
QELASQKQRQ EKMSDHKPLL TAISPGRGYW RRQLDHISAH LRCYAQNNPE
510 520 530 540 550
FRALIAEPRM GKLISATVHE DGCEVSIRLN YSQVSNKNLY LNKAVNFSDH
560 570 580 590 600
LLSSAAEGDG GLCGSRSSWV SDYSQSTSDT IEKIKRIKNF KTKTFQEKKE
610 620 630 640 650
QLIPENRLLL KEVGPTGEGR VSVIEQLLDE GADPNCCDED NRPVITVAVM
660 670 680 690 700
NKHHEAIPVL VQRGADIDQQ WGPLRNTALH EATLLGLAGR ESTATLLGCN
710 720 730 740 750
ASIQKKNAGG QTAYDLALNT GDDLVTSLFA AKFGQGLEDQ LAQTRSLSLD

DC
Length:752
Mass (Da):82,192
Last modified:December 14, 2011 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCF2DCF2969706264
GO
Isoform 2 (identifier: Q9NVP4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-173: Missing.
     174-180: RPPTRQS → MLTLESF
     414-414: E → EPRCAWQ

Note: No experimental confirmation available.
Show »
Length:585
Mass (Da):63,651
Checksum:i76E4D520E669D34E
GO
Isoform 3 (identifier: Q9NVP4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     538-574: NLYLNKAVNFSDHLLSSAAEGDGGLCGSRSSWVSDYS → VRKLRLREVKQPASSKGTKLVSGRPRIHTWQPETFPS
     575-752: Missing.

Show »
Length:574
Mass (Da):63,163
Checksum:i99D98A3A81100CF2
GO
Isoform 4 (identifier: Q9NVP4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-114: Missing.
     115-180: NVENVLKDSS...SGSRPPTRQS → MLTLESFQRV...GRTLFRRLLF

Show »
Length:638
Mass (Da):70,071
Checksum:i25C63FE48F1B0E6E
GO
Isoform 5 (identifier: Q9NVP4-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     319-359: Missing.

Show »
Length:711
Mass (Da):77,769
Checksum:iC4E442BA47D34D5E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
V9GY46V9GY46_HUMAN
Double zinc ribbon and ankyrin repe...
DZANK1
189Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J2A8C9J2A8_HUMAN
Double zinc ribbon and ankyrin repe...
DZANK1
462Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MRE2A0A0A0MRE2_HUMAN
Double zinc ribbon and ankyrin repe...
DZANK1
559Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WVH4A0A087WVH4_HUMAN
Double zinc ribbon and ankyrin repe...
DZANK1
225Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WTH2A0A087WTH2_HUMAN
Double zinc ribbon and ankyrin repe...
DZANK1
247Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087X236A0A087X236_HUMAN
Double zinc ribbon and ankyrin repe...
DZANK1
140Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA91706 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAB70949 differs from that shown. Reason: Erroneous termination at position 569. Translated as Trp.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti272A → V in BAB70949 (PubMed:14702039).Curated1
Sequence conflicti603I → L in AAZ13595 (Ref. 6) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0420901 – 173Missing in isoform 2. 1 PublicationAdd BLAST173
Alternative sequenceiVSP_0420911 – 114Missing in isoform 4. 1 PublicationAdd BLAST114
Alternative sequenceiVSP_042092115 – 180NVENV…PTRQS → MLTLESFQRVHWKSQLMVED QVLDHPPASPRQDTVPFTFK SFLFGHSMEIRPWKRKGRTL FRRLLF in isoform 4. 1 PublicationAdd BLAST66
Alternative sequenceiVSP_042093174 – 180RPPTRQS → MLTLESF in isoform 2. 1 Publication7
Alternative sequenceiVSP_042094319 – 359Missing in isoform 5. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_042095414E → EPRCAWQ in isoform 2. 1 Publication1
Alternative sequenceiVSP_042096538 – 574NLYLN…VSDYS → VRKLRLREVKQPASSKGTKL VSGRPRIHTWQPETFPS in isoform 3. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_042097575 – 752Missing in isoform 3. 1 PublicationAdd BLAST178

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK001462 mRNA Translation: BAA91706.1 Different initiation.
AK055544 mRNA Translation: BAB70949.1 Sequence problems.
AK131451 mRNA Translation: BAD18596.1
CR749327 mRNA Translation: CAH18182.1
AL049646 Genomic DNA No translation available.
AL121893 Genomic DNA No translation available.
CH471133 Genomic DNA Translation: EAX10244.1
BC144153 mRNA Translation: AAI44154.1
DQ104738 mRNA Translation: AAZ13595.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS46582.1 [Q9NVP4-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001092877.1, NM_001099407.1 [Q9NVP4-1]
XP_005260800.1, XM_005260743.3
XP_011527577.1, XM_011529275.2
XP_016883409.1, XM_017027920.1 [Q9NVP4-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000262547; ENSP00000262547; ENSG00000089091 [Q9NVP4-1]
ENST00000358866; ENSP00000351734; ENSG00000089091 [Q9NVP4-1]
ENST00000609267; ENSP00000477046; ENSG00000089091 [Q9NVP4-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
55184

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:55184

UCSC genome browser

More...
UCSCi
uc002wqq.5 human [Q9NVP4-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK001462 mRNA Translation: BAA91706.1 Different initiation.
AK055544 mRNA Translation: BAB70949.1 Sequence problems.
AK131451 mRNA Translation: BAD18596.1
CR749327 mRNA Translation: CAH18182.1
AL049646 Genomic DNA No translation available.
AL121893 Genomic DNA No translation available.
CH471133 Genomic DNA Translation: EAX10244.1
BC144153 mRNA Translation: AAI44154.1
DQ104738 mRNA Translation: AAZ13595.1
CCDSiCCDS46582.1 [Q9NVP4-1]
RefSeqiNP_001092877.1, NM_001099407.1 [Q9NVP4-1]
XP_005260800.1, XM_005260743.3
XP_011527577.1, XM_011529275.2
XP_016883409.1, XM_017027920.1 [Q9NVP4-2]

3D structure databases

SMRiQ9NVP4
ModBaseiSearch...

Protein-protein interaction databases

BioGridi120483, 5 interactors
IntActiQ9NVP4, 3 interactors
STRINGi9606.ENSP00000262547

PTM databases

iPTMnetiQ9NVP4
PhosphoSitePlusiQ9NVP4

Polymorphism and mutation databases

BioMutaiDZANK1
DMDMi363548518

Proteomic databases

EPDiQ9NVP4
jPOSTiQ9NVP4
MassIVEiQ9NVP4
PaxDbiQ9NVP4
PeptideAtlasiQ9NVP4
PRIDEiQ9NVP4
ProteomicsDBi82839 [Q9NVP4-1]
82840 [Q9NVP4-2]
82841 [Q9NVP4-3]
82842 [Q9NVP4-4]
82843 [Q9NVP4-5]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000262547; ENSP00000262547; ENSG00000089091 [Q9NVP4-1]
ENST00000358866; ENSP00000351734; ENSG00000089091 [Q9NVP4-1]
ENST00000609267; ENSP00000477046; ENSG00000089091 [Q9NVP4-3]
GeneIDi55184
KEGGihsa:55184
UCSCiuc002wqq.5 human [Q9NVP4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55184

GeneCards: human genes, protein and diseases

More...
GeneCardsi
DZANK1
HGNCiHGNC:15858 DZANK1
HPAiHPA059478
HPA064255
neXtProtiNX_Q9NVP4
OpenTargetsiENSG00000089091
PharmGKBiPA25660

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IEZB Eukaryota
ENOG410XPI2 LUCA
GeneTreeiENSGT00390000000549
InParanoidiQ9NVP4
OMAiPMNTPTC
OrthoDBi391157at2759
PhylomeDBiQ9NVP4
TreeFamiTF351270

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
DZANK1 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
55184

Pharos

More...
Pharosi
Q9NVP4

Protein Ontology

More...
PROi
PR:Q9NVP4

Gene expression databases

BgeeiENSG00000089091 Expressed in 156 organ(s), highest expression level in oviduct epithelium
ExpressionAtlasiQ9NVP4 baseline and differential
GenevisibleiQ9NVP4 HS

Family and domain databases

Gene3Di1.25.40.20, 1 hit
InterProiView protein in InterPro
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR025874 DZR
IPR026876 Fn3_assoc_repeat
PfamiView protein in Pfam
PF12773 DZR, 1 hit
PF13287 Fn3_assoc, 1 hit
SUPFAMiSSF48403 SSF48403, 1 hit
PROSITEiView protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDZAN1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NVP4
Secondary accession number(s): B7ZLZ4
, Q4F7X1, Q5QPD9, Q5QPE0, Q68DN8, Q6ZMX9, Q96NF0, Q9H1E0, Q9H442
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 15, 2002
Last sequence update: December 14, 2011
Last modified: September 18, 2019
This is version 149 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again