Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 166 (13 Nov 2019)
Sequence version 2 (02 May 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Disintegrin and metalloproteinase domain-containing protein 22

Gene

Adam22

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Probable ligand for integrin in the brain. This is a non catalytic metalloprotease-like protein. Involved in regulation of cell adhesion and spreading and in inhibition of cell proliferation (By similarity). Neuronal receptor for LGI1.By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-5682910 LGI-ADAM interactions

Protein family/group databases

MEROPS protease database

More...
MEROPSi
M12.978

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Disintegrin and metalloproteinase domain-containing protein 22
Short name:
ADAM 22
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Adam22
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1340046 Adam22

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini24 – 734ExtracellularSequence analysisAdd BLAST711
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei735 – 755HelicalSequence analysisAdd BLAST21
Topological domaini756 – 857CytoplasmicSequence analysisAdd BLAST102

Keywords - Cellular componenti

Cell membrane, Cell projection, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Mice display severe ataxia within one week after birth and die before weaning, probably due to convulsions. They display marked hypomyelination of the peripheral nerves.1 Publication

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi509D → N: Fails to bind to LGI1. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 23Sequence analysisAdd BLAST23
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_000002911424 – 223By similarityAdd BLAST200
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000029115224 – 904Disintegrin and metalloproteinase domain-containing protein 22Add BLAST681

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi163N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi347 ↔ 431By similarity
Disulfide bondi390 ↔ 415By similarity
Disulfide bondi392 ↔ 399By similarity
Disulfide bondi445 ↔ 475By similarity
Disulfide bondi456 ↔ 472By similarity
Disulfide bondi458 ↔ 464By similarity
Disulfide bondi471 ↔ 492By similarity
Disulfide bondi483 ↔ 489By similarity
Disulfide bondi488 ↔ 514By similarity
Disulfide bondi501 ↔ 521By similarity
Disulfide bondi508 ↔ 540By similarity
Glycosylationi517N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi533 ↔ 545By similarity
Disulfide bondi552 ↔ 603By similarity
Disulfide bondi567 ↔ 633By similarity
Disulfide bondi581 ↔ 591By similarity
Disulfide bondi598 ↔ 661By similarity
Glycosylationi632N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi655 ↔ 666By similarity
Glycosylationi673N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi677 ↔ 692By similarity
Disulfide bondi686 ↔ 698By similarity
Disulfide bondi700 ↔ 709By similarity
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei808PhosphoserineCombined sources1
Modified residuei832PhosphoserineCombined sources1
Modified residuei855PhosphoserineCombined sources1
Modified residuei860PhosphoserineCombined sources1
Modified residuei864PhosphoserineCombined sources1
Modified residuei868PhosphoserineCombined sources1
Isoform 8 (identifier: Q9R1V6-10)
Modified residuei817PhosphoserineCombined sources1
Isoform 12 (identifier: Q9R1V6-14)
Modified residuei882PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

The precursor is cleaved by a furin endopeptidase.By similarity

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9R1V6

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9R1V6

PeptideAtlas

More...
PeptideAtlasi
Q9R1V6

PRoteomics IDEntifications database

More...
PRIDEi
Q9R1V6

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
2258
2413 [Q9R1V6-16]
2443 [Q9R1V6-10]
2444 [Q9R1V6-11]

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9R1V6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9R1V6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in juxtaparanodal zones in the central nervous system and at nerve terminal plexuses of basket cells in the cerebellum (at protein level) (PubMed:20089912). Expressed at high levels in the brain. Strongly expressed in cerebellar granule cells and hippocampus. In spinal cord, expression is restricted to gray matter.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000040537 Expressed in 217 organ(s), highest expression level in brain

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9R1V6 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9R1V6 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with LGI1 (PubMed:18974846, PubMed:20089912). Can bind to LGI4(PubMed:18974846).

Interacts with KCNA2, DLG2 and DLG4 (PubMed:20089912).

3 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
197967, 5 interactors

Protein interaction database and analysis system

More...
IntActi
Q9R1V6, 8 interactors

Molecular INTeraction database

More...
MINTi
Q9R1V6

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000055000

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9R1V6

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini237 – 436Peptidase M12BPROSITE-ProRule annotationAdd BLAST200
Domaini442 – 529DisintegrinPROSITE-ProRule annotationAdd BLAST88
Domaini673 – 710EGF-likePROSITE-ProRule annotationAdd BLAST38

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi533 – 666Cys-richAdd BLAST134

Keywords - Domaini

EGF-like domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3607 Eukaryota
ENOG410XX2M LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156889

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9R1V6

KEGG Orthology (KO)

More...
KOi
K16068

Identification of Orthologs from Complete Genome Data

More...
OMAi
NMADMIF

Database of Orthologous Groups

More...
OrthoDBi
162519at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9R1V6

TreeFam database of animal gene trees

More...
TreeFami
TF314733

Family and domain databases

Conserved Domains Database

More...
CDDi
cd04269 ZnMc_adamalysin_II_like, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.390.10, 1 hit
4.10.70.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR006586 ADAM_Cys-rich
IPR018358 Disintegrin_CS
IPR001762 Disintegrin_dom
IPR036436 Disintegrin_dom_sf
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR013111 EGF_extracell
IPR024079 MetalloPept_cat_dom_sf
IPR001590 Peptidase_M12B
IPR002870 Peptidase_M12B_N
IPR034027 Reprolysin_adamalysin

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF08516 ADAM_CR, 1 hit
PF00200 Disintegrin, 1 hit
PF07974 EGF_2, 1 hit
PF01562 Pep_M12B_propep, 1 hit
PF01421 Reprolysin, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00289 DISINTEGRIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00608 ACR, 1 hit
SM00050 DISIN, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57552 SSF57552, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50215 ADAM_MEPRO, 1 hit
PS00427 DISINTEGRIN_1, 1 hit
PS50214 DISINTEGRIN_2, 1 hit
PS00022 EGF_1, 1 hit
PS50026 EGF_3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (21+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 21 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 21 described isoforms and 16 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9R1V6-3) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G01, 22g

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQAAAAASFW LLCVLGTCPL ARCGRAGVAS LKGLERGKEN RFLERQSIIP
60 70 80 90 100
LRLIYRLGGE DETQHNQLDT RVRGDPGGPQ LTHVDKASFR VDAFGTSFVL
110 120 130 140 150
DVLLNHELLS SGYVERQIEH GGKVVENKGG EHCYYQGQIR GNPVSFVALS
160 170 180 190 200
TCHGLHGMFY DGNHTYLIEP EENEKSQESS HCHSVYKSRQ FEFPLDDLPS
210 220 230 240 250
EFQRVNITPP QFILKPRLKR RKRQLLRFPR NVEEETKYIE LMIVNDHLMF
260 270 280 290 300
KKHRLSVVYT NTYAKSVVNM ADVIYKDQLK TRIVLVAMET WAADNKFAIS
310 320 330 340 350
ENPLITLREF MKYRRDFIKE KADAVHLFSG SQFESSRSGA AYIGGICSLL
360 370 380 390 400
RGGGVNEFGK TDLMAVTLAQ SLAHNVGIIS DKRKLASGEC KCEDTWSGCI
410 420 430 440 450
MGDTGYYLPK KFTQCNVEEY HDFLNSGGGA CLFNKPSKLL DPPECGNGFI
460 470 480 490 500
ETGEECDCGT PAECALEGAE CCKKCTLTQD SQCSDGLCCK KCKFQPLGTV
510 520 530 540 550
CREAVNDCDI REICSGNSSQ CAPNVHKMDG YSCDGTQGIC FGGRCKTRDR
560 570 580 590 600
QCKYIWGQKV TASDRYCYEK LNIEGTEKGN CGKDKDTWTQ CNKRDVLCGY
610 620 630 640 650
LLCTNIGNIP RLGELDGEIT STLVVQQGRT LNCSGAHVKL EEDVDLGYVE
660 670 680 690 700
DGTPCGPQMM CLEHRCLPVA SFNFSTCSSS KAGTVCSGNG VCSNELKCVC
710 720 730 740 750
NRHWTGADCG THFPHNDDAK TGITLSGNGV AGTNIIIGII AGTILVLALI
760 770 780 790 800
LGITAWGYKN YREQRQLPQG DYVKKPGDGD SFYSDFPPGG STNSASSSKK
810 820 830 840 850
RSNGLSHSWS ERIPDTKHIS DICENGRPRS NSWQGNMGGN KKKIRGKRFR
860 870 880 890 900
PRSNSTETLS PAKSPSSSTG SIASSRKYPY PMPPLPDEGK TAGRQSARLW

ETSI
Length:904
Mass (Da):99,715
Last modified:May 2, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0FBBD09398EE0B97
GO
Isoform 2 (identifier: Q9R1V6-4) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G03, 22g(D27)

The sequence of this isoform differs from the canonical sequence as follows:
     766-801: Missing.

Show »
Length:868
Mass (Da):95,927
Checksum:iC0FA966057D2C5C8
GO
Isoform 3 (identifier: Q9R1V6-5) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G06, 22g(D26D27)

The sequence of this isoform differs from the canonical sequence as follows:
     760-801: Missing.

Show »
Length:862
Mass (Da):95,080
Checksum:i17E4012489871450
GO
Isoform 4 (identifier: Q9R1V6-6) [UniParc]FASTAAdd to basket
Also known as: ADAM22=G07, 22g(D26D27)+29.3

The sequence of this isoform differs from the canonical sequence as follows:
     760-801: Missing.
     857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHR

Show »
Length:899
Mass (Da):98,855
Checksum:iDAFB8A148524416E
GO
Isoform 5 (identifier: Q9R1V6-7) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G08, 22g(D27)+29.3

The sequence of this isoform differs from the canonical sequence as follows:
     766-801: Missing.
     857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHR

Show »
Length:905
Mass (Da):99,702
Checksum:i6AAA73D541AFB536
GO
Isoform 6 (identifier: Q9R1V6-8) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G09, 22g+29.3

The sequence of this isoform differs from the canonical sequence as follows:
     857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHR

Show »
Length:941
Mass (Da):103,490
Checksum:iD23B93F0032CBBCF
GO
Isoform 7 (identifier: Q9R1V6-9) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G10, 22g+29.1

The sequence of this isoform differs from the canonical sequence as follows:
     857-904: ETLSPAKSPSSSTGSIASSRKYPYPMPPLPDEGKTAGRQSARLWETSI → DLGIIT

Show »
Length:862
Mass (Da):95,224
Checksum:i30A066885BBA38FB
GO
Isoform 8 (identifier: Q9R1V6-10) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G11, 22g(D27)+29.5+29.7

The sequence of this isoform differs from the canonical sequence as follows:
     766-801: Missing.
     857-857: E → EYLNPWFKRDYNVAKWVEDVNKNTEGPYFSSQDSPHQQDR

Show »
Length:907
Mass (Da):100,669
Checksum:iE228AF65D914F778
GO
Isoform 9 (identifier: Q9R1V6-11) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G12, 22g+29.3+29.7

The sequence of this isoform differs from the canonical sequence as follows:
     857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHRYLNPWFKRDYNVAKWVEDVNKNTEGPYFR

Show »
Length:970
Mass (Da):107,122
Checksum:iABBCD4AD024F349B
GO
Isoform 10 (identifier: Q9R1V6-12) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G17, 22G[27L]+29.3+29.7

The sequence of this isoform differs from the canonical sequence as follows:
     802-802: S → SAFLSHFQISTCSITHYSISQNISLFCSRS
     857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHSSQDGPHQQDR

Show »
Length:980
Mass (Da):107,831
Checksum:i45BE20975A1D5820
GO
Isoform 11 (identifier: Q9R1V6-13) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G18, 22g(D26)[27L]

The sequence of this isoform differs from the canonical sequence as follows:
     760-765: Missing.
     802-802: S → SAFLSHFQISTCSITHYSISQNISLFCSRS

Show »
Length:927
Mass (Da):102,129
Checksum:iBD4C6B317C47EFAB
GO
Isoform 12 (identifier: Q9R1V6-14) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G19, 22g[27L]+29.5

The sequence of this isoform differs from the canonical sequence as follows:
     802-802: S → SAFLSHFQISTCSITHYSISQNISLFCSRS
     857-857: E → EYLNPWFKRDYNVAKWVEDVNKNTEGPYFR

Show »
Length:962
Mass (Da):106,608
Checksum:iD77057A06FD2A7E4
GO
Isoform 13 (identifier: Q9R1V6-15) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G20, 22g[27L]

The sequence of this isoform differs from the canonical sequence as follows:
     802-802: S → SAFLSHFQISTCSITHYSISQNISLFCSRS

Show »
Length:933
Mass (Da):102,976
Checksum:i1052AC188694EDFC
GO
Isoform 14 (identifier: Q9R1V6-16) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G21, 22g(D26)[27S]

The sequence of this isoform differs from the canonical sequence as follows:
     760-904: NYREQRQLPQ...QSARLWETSI → FPPVPSHIIP...RAPGYGRHPF

Show »
Length:883
Mass (Da):97,640
Checksum:iC3A2C695E08B72F9
GO
Isoform 15 (identifier: Q9R1V6-17) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G22, 22g(D27)+29.7

The sequence of this isoform differs from the canonical sequence as follows:
     766-801: Missing.
     857-857: E → DSQDGPHQQDR

Show »
Length:878
Mass (Da):97,062
Checksum:i251D63D6D6CAF0A3
GO
Isoform 16 (identifier: Q9R1V6-18) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G23, 22g(D25D26D27)

The sequence of this isoform differs from the canonical sequence as follows:
     730-904: VAGTNIIIGI...QSARLWETSI → QMDSLILGVK...RAPGYGRHPF

Show »
Length:832
Mass (Da):92,271
Checksum:i6BB6F0B5CA150F28
GO
Isoform 17 (identifier: Q9R1V6-2) [UniParc]FASTAAdd to basket
Also known as: ADAM22-A05, Beta

The sequence of this isoform differs from the canonical sequence as follows:
     766-801: Missing.
     858-904: Missing.

Show »
Length:821
Mass (Da):90,952
Checksum:i4F8F12B425EB683C
GO
Isoform 18 (identifier: Q9R1V6-19) [UniParc]FASTAAdd to basket
Also known as: ADAM22-A13

The sequence of this isoform differs from the canonical sequence as follows:
     760-801: Missing.
     858-904: Missing.

Show »
Length:815
Mass (Da):90,105
Checksum:i59F2A397E25E283F
GO
Isoform 19 (identifier: Q9R1V6-20) [UniParc]FASTAAdd to basket
Also known as: ADAM22-A15

The sequence of this isoform differs from the canonical sequence as follows:
     760-765: Missing.
     858-904: Missing.

Show »
Length:851
Mass (Da):93,893
Checksum:iB1A6A8713614459E
GO
Isoform 20 (identifier: Q9R1V6-1) [UniParc]FASTAAdd to basket
Also known as: ADAM22-A04, Alpha

The sequence of this isoform differs from the canonical sequence as follows:
     858-904: Missing.

Show »
Length:857
Mass (Da):94,740
Checksum:iCB88FB7000208E09
GO
Isoform 21 (identifier: Q9R1V6-21) [UniParc]FASTAAdd to basket
Also known as: ADAM22-A16

The sequence of this isoform differs from the canonical sequence as follows:
     766-846: QLPQGDYVKK...MGGNKKKIRG → FPPVPSHIIP...DLTQLSKLYL
     847-904: Missing.

Show »
Length:846
Mass (Da):93,592
Checksum:i08A647F010B67028
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 16 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3YUP9D3YUP9_MOUSE
Disintegrin and metalloproteinase d...
Adam22
897Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F7CDH3F7CDH3_MOUSE
Disintegrin and metalloproteinase d...
Adam22
251Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6PZ09F6PZ09_MOUSE
Disintegrin and metalloproteinase d...
Adam22
267Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6VJ78F6VJ78_MOUSE
Disintegrin and metalloproteinase d...
Adam22
220Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6XIT3F6XIT3_MOUSE
Disintegrin and metalloproteinase d...
Adam22
251Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F7DAP1F7DAP1_MOUSE
Disintegrin and metalloproteinase d...
Adam22
249Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F7AYY9F7AYY9_MOUSE
Disintegrin and metalloproteinase d...
Adam22
194Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F7BZ55F7BZ55_MOUSE
Disintegrin and metalloproteinase d...
Adam22
228Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6SK63F6SK63_MOUSE
Disintegrin and metalloproteinase d...
Adam22
186Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6XRZ6F6XRZ6_MOUSE
Disintegrin and metalloproteinase d...
Adam22
191Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti639K → R in BAC28742 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_018233730 – 904VAGTN…WETSI → QMDSLILGVKGFQTQNIFQT SVKMGDLAVTPGKVTWEATK RKSEGKDLDLDLTQLRPCHL PSLLLHQLGLLPPAENTRTL CLRFQTRGRQRADRAPGYGR HPF in isoform 16. 1 PublicationAdd BLAST175
Alternative sequenceiVSP_018234760 – 904NYREQ…WETSI → FPPVPSHIIPLVRTFHYFAA GQMDSLILGVKGFQTQNIFQ TSVKMGDLAVTPGKVTWEAT KRKSEGKDLDLDLTQLRPCH LPSLLLHQLGLLPPAENTRT LCLRFQTRGRQRADRAPGYG RHPF in isoform 14. 1 PublicationAdd BLAST145
Alternative sequenceiVSP_018235760 – 801Missing in isoform 3, isoform 4 and isoform 18. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_018236760 – 765Missing in isoform 11 and isoform 19. 1 Publication6
Alternative sequenceiVSP_018237766 – 846QLPQG…KKIRG → FPPVPSHIIPLVRTFHYFAA GQMDSLILGVKGFQTQNIFQ TSVKMGDLAVTPGKVTWEAT KRKSEGKDLDLDLTQLSKLY L in isoform 21. 1 PublicationAdd BLAST81
Alternative sequenceiVSP_018238766 – 801Missing in isoform 2, isoform 5, isoform 8, isoform 15 and isoform 17. 3 PublicationsAdd BLAST36
Alternative sequenceiVSP_018239802S → SAFLSHFQISTCSITHYSIS QNISLFCSRS in isoform 10, isoform 11, isoform 12 and isoform 13. 1 Publication1
Alternative sequenceiVSP_018240847 – 904Missing in isoform 21. 1 PublicationAdd BLAST58
Alternative sequenceiVSP_018241857 – 904ETLSP…WETSI → DLGIIT in isoform 7. 1 PublicationAdd BLAST48
Alternative sequenceiVSP_018242857E → EREPQAPEPGHSLAQTIPSQ GISPGGSDSPQTGSLDHSSQ DGPHQQDR in isoform 10. 1 Publication1
Alternative sequenceiVSP_018243857E → EYLNPWFKRDYNVAKWVEDV NKNTEGPYFR in isoform 12. 1 Publication1
Alternative sequenceiVSP_018244857E → DSQDGPHQQDR in isoform 15. 1 Publication1
Alternative sequenceiVSP_018245857E → EREPQAPEPGHSLAQTIPSQ GISPGGSDSPQTGSLDHR in isoform 4, isoform 5 and isoform 6. 1 Publication1
Alternative sequenceiVSP_018246857E → EYLNPWFKRDYNVAKWVEDV NKNTEGPYFSSQDSPHQQDR in isoform 8. 1 Publication1
Alternative sequenceiVSP_018247857E → EREPQAPEPGHSLAQTIPSQ GISPGGSDSPQTGSLDHRYL NPWFKRDYNVAKWVEDVNKN TEGPYFR in isoform 9. 1 Publication1
Alternative sequenceiVSP_018248858 – 904Missing in isoform 17, isoform 18, isoform 19 and isoform 20. 2 PublicationsAdd BLAST47

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB009674 mRNA Translation: BAA83382.1
AB009674 mRNA Translation: BAA83383.1
AK034528 mRNA Translation: BAC28742.1
AB179842 mRNA Translation: BAD72803.1
AB179843 mRNA Translation: BAD72804.1
AB179844 mRNA Translation: BAD72805.1
AB179845 mRNA Translation: BAD72806.1
AB179846 mRNA Translation: BAD72807.1
AB179847 mRNA Translation: BAD72808.1
AB179848 mRNA Translation: BAD72809.1
AB179849 mRNA Translation: BAD72810.1
AB179850 mRNA Translation: BAD72811.1
AB179851 mRNA Translation: BAD72812.1
AB179852 mRNA Translation: BAD72813.1
AB179853 mRNA Translation: BAD72814.1
AB179854 mRNA Translation: BAD72815.1
AB179855 mRNA Translation: BAD72816.1
AB179856 mRNA Translation: BAD72817.1
AB179857 mRNA Translation: BAD72818.1
AB179858 mRNA Translation: BAD72819.1
AB179859 mRNA Translation: BAD72820.1
AB179860 mRNA Translation: BAD72821.1
AB179861 mRNA Translation: BAD72822.1
AB179862 mRNA Translation: BAD72823.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS19080.1 [Q9R1V6-1]
CCDS51411.1 [Q9R1V6-4]
CCDS80205.1 [Q9R1V6-6]
CCDS80207.1 [Q9R1V6-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001007221.1, NM_001007220.3 [Q9R1V6-1]
NP_001007222.1, NM_001007221.3 [Q9R1V6-2]
NP_001091695.1, NM_001098225.2 [Q9R1V6-4]
NP_001297368.1, NM_001310439.1 [Q9R1V6-6]
NP_001297369.1, NM_001310440.1 [Q9R1V6-3]
XP_006503592.1, XM_006503529.3 [Q9R1V6-12]
XP_006503593.1, XM_006503530.3 [Q9R1V6-11]
XP_006503594.1, XM_006503531.3 [Q9R1V6-14]
XP_006503596.1, XM_006503533.3 [Q9R1V6-8]
XP_006503598.1, XM_006503535.3 [Q9R1V6-15]
XP_006503600.1, XM_006503537.3 [Q9R1V6-7]
XP_006503605.1, XM_006503542.3 [Q9R1V6-5]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000046838; ENSMUSP00000049120; ENSMUSG00000040537 [Q9R1V6-1]
ENSMUST00000050166; ENSMUSP00000055000; ENSMUSG00000040537 [Q9R1V6-4]
ENSMUST00000088744; ENSMUSP00000086122; ENSMUSG00000040537 [Q9R1V6-13]
ENSMUST00000088761; ENSMUSP00000086139; ENSMUSG00000040537 [Q9R1V6-3]
ENSMUST00000115388; ENSMUSP00000111046; ENSMUSG00000040537 [Q9R1V6-6]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
11496

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:11496

UCSC genome browser

More...
UCSCi
uc008wjk.2 mouse [Q9R1V6-3]
uc008wjv.1 mouse [Q9R1V6-4]
uc008wjy.1 mouse [Q9R1V6-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB009674 mRNA Translation: BAA83382.1
AB009674 mRNA Translation: BAA83383.1
AK034528 mRNA Translation: BAC28742.1
AB179842 mRNA Translation: BAD72803.1
AB179843 mRNA Translation: BAD72804.1
AB179844 mRNA Translation: BAD72805.1
AB179845 mRNA Translation: BAD72806.1
AB179846 mRNA Translation: BAD72807.1
AB179847 mRNA Translation: BAD72808.1
AB179848 mRNA Translation: BAD72809.1
AB179849 mRNA Translation: BAD72810.1
AB179850 mRNA Translation: BAD72811.1
AB179851 mRNA Translation: BAD72812.1
AB179852 mRNA Translation: BAD72813.1
AB179853 mRNA Translation: BAD72814.1
AB179854 mRNA Translation: BAD72815.1
AB179855 mRNA Translation: BAD72816.1
AB179856 mRNA Translation: BAD72817.1
AB179857 mRNA Translation: BAD72818.1
AB179858 mRNA Translation: BAD72819.1
AB179859 mRNA Translation: BAD72820.1
AB179860 mRNA Translation: BAD72821.1
AB179861 mRNA Translation: BAD72822.1
AB179862 mRNA Translation: BAD72823.1
CCDSiCCDS19080.1 [Q9R1V6-1]
CCDS51411.1 [Q9R1V6-4]
CCDS80205.1 [Q9R1V6-6]
CCDS80207.1 [Q9R1V6-3]
RefSeqiNP_001007221.1, NM_001007220.3 [Q9R1V6-1]
NP_001007222.1, NM_001007221.3 [Q9R1V6-2]
NP_001091695.1, NM_001098225.2 [Q9R1V6-4]
NP_001297368.1, NM_001310439.1 [Q9R1V6-6]
NP_001297369.1, NM_001310440.1 [Q9R1V6-3]
XP_006503592.1, XM_006503529.3 [Q9R1V6-12]
XP_006503593.1, XM_006503530.3 [Q9R1V6-11]
XP_006503594.1, XM_006503531.3 [Q9R1V6-14]
XP_006503596.1, XM_006503533.3 [Q9R1V6-8]
XP_006503598.1, XM_006503535.3 [Q9R1V6-15]
XP_006503600.1, XM_006503537.3 [Q9R1V6-7]
XP_006503605.1, XM_006503542.3 [Q9R1V6-5]

3D structure databases

SMRiQ9R1V6
ModBaseiSearch...

Protein-protein interaction databases

BioGridi197967, 5 interactors
IntActiQ9R1V6, 8 interactors
MINTiQ9R1V6
STRINGi10090.ENSMUSP00000055000

Protein family/group databases

MEROPSiM12.978

PTM databases

GlyConnecti2258
2413 [Q9R1V6-16]
2443 [Q9R1V6-10]
2444 [Q9R1V6-11]
iPTMnetiQ9R1V6
PhosphoSitePlusiQ9R1V6

Proteomic databases

MaxQBiQ9R1V6
PaxDbiQ9R1V6
PeptideAtlasiQ9R1V6
PRIDEiQ9R1V6

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
11496

Genome annotation databases

EnsembliENSMUST00000046838; ENSMUSP00000049120; ENSMUSG00000040537 [Q9R1V6-1]
ENSMUST00000050166; ENSMUSP00000055000; ENSMUSG00000040537 [Q9R1V6-4]
ENSMUST00000088744; ENSMUSP00000086122; ENSMUSG00000040537 [Q9R1V6-13]
ENSMUST00000088761; ENSMUSP00000086139; ENSMUSG00000040537 [Q9R1V6-3]
ENSMUST00000115388; ENSMUSP00000111046; ENSMUSG00000040537 [Q9R1V6-6]
GeneIDi11496
KEGGimmu:11496
UCSCiuc008wjk.2 mouse [Q9R1V6-3]
uc008wjv.1 mouse [Q9R1V6-4]
uc008wjy.1 mouse [Q9R1V6-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
53616
MGIiMGI:1340046 Adam22

Phylogenomic databases

eggNOGiKOG3607 Eukaryota
ENOG410XX2M LUCA
GeneTreeiENSGT00940000156889
InParanoidiQ9R1V6
KOiK16068
OMAiNMADMIF
OrthoDBi162519at2759
PhylomeDBiQ9R1V6
TreeFamiTF314733

Enzyme and pathway databases

ReactomeiR-MMU-5682910 LGI-ADAM interactions

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Adam22 mouse

Protein Ontology

More...
PROi
PR:Q9R1V6

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000040537 Expressed in 217 organ(s), highest expression level in brain
ExpressionAtlasiQ9R1V6 baseline and differential
GenevisibleiQ9R1V6 MM

Family and domain databases

CDDicd04269 ZnMc_adamalysin_II_like, 1 hit
Gene3Di3.40.390.10, 1 hit
4.10.70.10, 1 hit
InterProiView protein in InterPro
IPR006586 ADAM_Cys-rich
IPR018358 Disintegrin_CS
IPR001762 Disintegrin_dom
IPR036436 Disintegrin_dom_sf
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR013111 EGF_extracell
IPR024079 MetalloPept_cat_dom_sf
IPR001590 Peptidase_M12B
IPR002870 Peptidase_M12B_N
IPR034027 Reprolysin_adamalysin
PfamiView protein in Pfam
PF08516 ADAM_CR, 1 hit
PF00200 Disintegrin, 1 hit
PF07974 EGF_2, 1 hit
PF01562 Pep_M12B_propep, 1 hit
PF01421 Reprolysin, 1 hit
PRINTSiPR00289 DISINTEGRIN
SMARTiView protein in SMART
SM00608 ACR, 1 hit
SM00050 DISIN, 1 hit
SUPFAMiSSF57552 SSF57552, 1 hit
PROSITEiView protein in PROSITE
PS50215 ADAM_MEPRO, 1 hit
PS00427 DISINTEGRIN_1, 1 hit
PS50214 DISINTEGRIN_2, 1 hit
PS00022 EGF_1, 1 hit
PS50026 EGF_3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiADA22_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9R1V6
Secondary accession number(s): Q5TLI8
, Q5TLI9, Q5TLJ0, Q5TLJ1, Q5TLJ2, Q5TLJ3, Q5TLJ4, Q5TLJ5, Q5TLJ6, Q5TLJ7, Q5TLJ8, Q5TLJ9, Q5TLK0, Q5TLK1, Q5TLK2, Q5TLK3, Q5TLK4, Q5TLK5, Q5TLK6, Q5TLK7, Q5TLK8, Q8BSF2, Q9R1V5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 20, 2001
Last sequence update: May 2, 2006
Last modified: November 13, 2019
This is version 166 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again