Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 184 (18 Sep 2019)
Sequence version 2 (21 Feb 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Targeting protein for Xklp2

Gene

TPX2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Spindle assembly factor required for normal assembly of mitotic spindles. Required for normal assembly of microtubules during apoptosis. Required for chromatin and/or kinetochore dependent microtubule nucleation. Mediates AURKA localization to spindle microtubules (PubMed:18663142, PubMed:19208764). Activates AURKA by promoting its autophosphorylation at 'Thr-288' and protects this residue against dephosphorylation (PubMed:18663142, PubMed:19208764). TPX2 is inactivated upon binding to importin-alpha (PubMed:26165940). At the onset of mitosis, GOLGA2 interacts with importin-alpha, liberating TPX2 from importin-alpha, allowing TPX2 to activates AURKA kinase and stimulates local microtubule nucleation (PubMed:26165940).3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processApoptosis, Cell cycle, Cell division, Mitosis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-6804756 Regulation of TP53 Activity through Phosphorylation
R-HSA-8854518 AURKA Activation by TPX2

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Targeting protein for Xklp2
Alternative name(s):
Differentially expressed in cancerous and non-cancerous lung cells 2
Short name:
DIL-2
Hepatocellular carcinoma-associated antigen 519
Hepatocellular carcinoma-associated antigen 90
Protein fls353
Restricted expression proliferation-associated protein 100
Short name:
p100
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TPX2
Synonyms:C20orf1, C20orf2, DIL2, HCA519
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 20

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:1249 TPX2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605917 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9ULW0

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
22974

Open Targets

More...
OpenTargetsi
ENSG00000088325

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA25638

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL5389

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TPX2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
13124096

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000655811 – 747Targeting protein for Xklp2Add BLAST747

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei59PhosphothreonineCombined sources1
Modified residuei72PhosphothreonineCombined sources1
Modified residuei121PhosphoserineCombined sources1
Modified residuei125PhosphoserineCombined sources1
Modified residuei128N6-acetyllysineBy similarity1
Modified residuei147PhosphothreonineCombined sources1
Modified residuei257PhosphoserineCombined sources1
Modified residuei292PhosphoserineCombined sources1
Modified residuei293PhosphoserineCombined sources1
Modified residuei305N6-acetyllysineCombined sources1
Modified residuei310PhosphoserineCombined sources1
Modified residuei338PhosphothreonineCombined sources1
Modified residuei359PhosphoserineCombined sources1
Modified residuei369PhosphothreonineCombined sources1
Modified residuei375N6-acetyllysineBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki477Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei486PhosphoserineCombined sources1
Modified residuei499PhosphothreonineCombined sources1
Cross-linki500Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki641Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei738PhosphoserineCombined sources1
Cross-linki740Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

The CPTAC Assay portal

More...
CPTACi
CPTAC-1016

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9ULW0

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9ULW0

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9ULW0

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9ULW0

PeptideAtlas

More...
PeptideAtlasi
Q9ULW0

PRoteomics IDEntifications database

More...
PRIDEi
Q9ULW0

ProteomicsDB human proteome resource

More...
ProteomicsDBi
78016
85139 [Q9ULW0-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9ULW0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9ULW0

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q9ULW0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in lung carcinoma cell lines but not in normal lung tissues.

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Exclusively expressed in proliferating cells from the transition G1/S until the end of cytokinesis.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000088325 Expressed in 140 organ(s), highest expression level in embryo

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9ULW0 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9ULW0 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA005487

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with AURKA (PubMed:14580337, PubMed:18662907, PubMed:18663142).

Interacts with importin-alpha; leading to inactivate TPX2 (PubMed:26165940).

Interacts with HNRNPU; this interaction recruits HNRNPU to spindle microtubules (MTs) (PubMed:21242313, PubMed:25986610).

6 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116624, 48 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q9ULW0

Database of interacting proteins

More...
DIPi
DIP-36727N
DIP-46212N

Protein interaction database and analysis system

More...
IntActi
Q9ULW0, 30 interactors

Molecular INTeraction database

More...
MINTi
Q9ULW0

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000300403

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1747
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9ULW0

Database of comparative protein structure models

More...
ModBasei
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9ULW0

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TPX2 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IIEY Eukaryota
ENOG4110SQ6 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000009842

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231739

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9ULW0

KEGG Orthology (KO)

More...
KOi
K16812

Identification of Orthologs from Complete Genome Data

More...
OMAi
PTQPVGF

Database of Orthologous Groups

More...
OrthoDBi
1390734at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9ULW0

TreeFam database of animal gene trees

More...
TreeFami
TF328997

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR015128 Aurora-A-bd
IPR027329 TPX2_C
IPR027330 TPX2_central_dom
IPR009675 TPX2_fam

The PANTHER Classification System

More...
PANTHERi
PTHR14326 PTHR14326, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF09041 Aurora-A_bind, 1 hit
PF06886 TPX2, 1 hit
PF12214 TPX2_importin, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9ULW0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSQVKSSYSY DAPSDFINFS SLDDEGDTQN IDSWFEEKAN LENKLLGKNG
60 70 80 90 100
TGGLFQGKTP LRKANLQQAI VTPLKPVDNT YYKEAEKENL VEQSIPSNAC
110 120 130 140 150
SSLEVEAAIS RKTPAQPQRR SLRLSAQKDL EQKEKHHVKM KAKRCATPVI
160 170 180 190 200
IDEILPSKKM KVSNNKKKPE EEGSAHQDTA EKNASSPEKA KGRHTVPCMP
210 220 230 240 250
PAKQKFLKST EEQELEKSMK MQQEVVEMRK KNEEFKKLAL AGIGQPVKKS
260 270 280 290 300
VSQVTKSVDF HFRTDERIKQ HPKNQEEYKE VNFTSELRKH PSSPARVTKG
310 320 330 340 350
CTIVKPFNLS QGKKRTFDET VSTYVPLAQQ VEDFHKRTPN RYHLRSKKDD
360 370 380 390 400
INLLPSKSSV TKICRDPQTP VLQTKHRARA VTCKSTAELE AEELEKLQQY
410 420 430 440 450
KFKARELDPR ILEGGPILPK KPPVKPPTEP IGFDLEIEKR IQERESKKKT
460 470 480 490 500
EDEHFEFHSR PCPTKILEDV VGVPEKKVLP ITVPKSPAFA LKNRIRMPTK
510 520 530 540 550
EDEEEDEPVV IKAQPVPHYG VPFKPQIPEA RTVEICPFSF DSRDKERQLQ
560 570 580 590 600
KEKKIKELQK GEVPKFKALP LPHFDTINLP EKKVKNVTQI EPFCLETDRR
610 620 630 640 650
GALKAQTWKH QLEEELRQQK EAACFKARPN TVISQEPFVP KKEKKSVAEG
660 670 680 690 700
LSGSLVQEPF QLATEKRAKE RQELEKRMAE VEAQKAQQLE EARLQEEEQK
710 720 730 740
KEELARLRRE LVHKANPIRK YQGLEIKSSD QPLTVPVSPK FSTRFHC
Length:747
Mass (Da):85,653
Last modified:February 21, 2001 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE028E0BB50BBCA0F
GO
Isoform 2 (identifier: Q9ULW0-2) [UniParc]FASTAAdd to basket
Also known as: HCA90

The sequence of this isoform differs from the canonical sequence as follows:
     351-351: I → IKTGSCSVTQAGVQWRDHGSLQCPTPGLKQSSCLSLP

Note: No experimental confirmation available.
Show »
Length:783
Mass (Da):89,393
Checksum:i10C8E4122A53BF9E
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti182K → N in BAA76931 (Ref. 3) Curated1
Sequence conflicti273K → E in BAA85893 (PubMed:10512675).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_036269464T → N in a colorectal cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_057355351I → IKTGSCSVTQAGVQWRDHGS LQCPTPGLKQSSCLSLP in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB027467 mRNA Translation: BAA85893.1
AF098158 mRNA Translation: AAF03248.1
AB024704 mRNA Translation: BAA76931.1
AF146731 mRNA Translation: AAD33965.1
AF287265 mRNA Translation: AAK83033.1
AL160175 Genomic DNA No translation available.
CH471077 Genomic DNA Translation: EAW76418.1
CH471077 Genomic DNA Translation: EAW76422.1
BC004136 mRNA Translation: AAH04136.1
BC020207 mRNA Translation: AAH20207.1
AL117534 mRNA Translation: CAB55982.1
AF244547 mRNA Translation: AAF81695.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS13190.1 [Q9ULW0-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
T17292

NCBI Reference Sequences

More...
RefSeqi
NP_036244.2, NM_012112.4 [Q9ULW0-1]
XP_011526999.1, XM_011528697.2 [Q9ULW0-1]
XP_011527001.1, XM_011528699.2 [Q9ULW0-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000300403; ENSP00000300403; ENSG00000088325 [Q9ULW0-1]
ENST00000340513; ENSP00000341145; ENSG00000088325 [Q9ULW0-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
22974

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:22974

UCSC genome browser

More...
UCSCi
uc002wwp.2 human [Q9ULW0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB027467 mRNA Translation: BAA85893.1
AF098158 mRNA Translation: AAF03248.1
AB024704 mRNA Translation: BAA76931.1
AF146731 mRNA Translation: AAD33965.1
AF287265 mRNA Translation: AAK83033.1
AL160175 Genomic DNA No translation available.
CH471077 Genomic DNA Translation: EAW76418.1
CH471077 Genomic DNA Translation: EAW76422.1
BC004136 mRNA Translation: AAH04136.1
BC020207 mRNA Translation: AAH20207.1
AL117534 mRNA Translation: CAB55982.1
AF244547 mRNA Translation: AAF81695.1
CCDSiCCDS13190.1 [Q9ULW0-1]
PIRiT17292
RefSeqiNP_036244.2, NM_012112.4 [Q9ULW0-1]
XP_011526999.1, XM_011528697.2 [Q9ULW0-1]
XP_011527001.1, XM_011528699.2 [Q9ULW0-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1OL5X-ray2.50B1-43[»]
3E5AX-ray2.30B1-43[»]
3HA6X-ray2.36B1-43[»]
4C3PX-ray2.69B/E1-43[»]
5LXMX-ray2.08D6-43[»]
6BJCelectron microscopy3.30P/T1-747[»]
SMRiQ9ULW0
ModBaseiSearch...

Protein-protein interaction databases

BioGridi116624, 48 interactors
CORUMiQ9ULW0
DIPiDIP-36727N
DIP-46212N
IntActiQ9ULW0, 30 interactors
MINTiQ9ULW0
STRINGi9606.ENSP00000300403

Chemistry databases

ChEMBLiCHEMBL5389

PTM databases

iPTMnetiQ9ULW0
PhosphoSitePlusiQ9ULW0
SwissPalmiQ9ULW0

Polymorphism and mutation databases

BioMutaiTPX2
DMDMi13124096

Proteomic databases

CPTACiCPTAC-1016
EPDiQ9ULW0
jPOSTiQ9ULW0
MassIVEiQ9ULW0
PaxDbiQ9ULW0
PeptideAtlasiQ9ULW0
PRIDEiQ9ULW0
ProteomicsDBi78016
85139 [Q9ULW0-1]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000300403; ENSP00000300403; ENSG00000088325 [Q9ULW0-1]
ENST00000340513; ENSP00000341145; ENSG00000088325 [Q9ULW0-2]
GeneIDi22974
KEGGihsa:22974
UCSCiuc002wwp.2 human [Q9ULW0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
22974
DisGeNETi22974

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TPX2
HGNCiHGNC:1249 TPX2
HPAiHPA005487
MIMi605917 gene
neXtProtiNX_Q9ULW0
OpenTargetsiENSG00000088325
PharmGKBiPA25638

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IIEY Eukaryota
ENOG4110SQ6 LUCA
GeneTreeiENSGT00390000009842
HOGENOMiHOG000231739
InParanoidiQ9ULW0
KOiK16812
OMAiPTQPVGF
OrthoDBi1390734at2759
PhylomeDBiQ9ULW0
TreeFamiTF328997

Enzyme and pathway databases

ReactomeiR-HSA-6804756 Regulation of TP53 Activity through Phosphorylation
R-HSA-8854518 AURKA Activation by TPX2

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TPX2 human
EvolutionaryTraceiQ9ULW0

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
TPX2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
22974

Pharos

More...
Pharosi
Q9ULW0

Protein Ontology

More...
PROi
PR:Q9ULW0

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000088325 Expressed in 140 organ(s), highest expression level in embryo
ExpressionAtlasiQ9ULW0 baseline and differential
GenevisibleiQ9ULW0 HS

Family and domain databases

InterProiView protein in InterPro
IPR015128 Aurora-A-bd
IPR027329 TPX2_C
IPR027330 TPX2_central_dom
IPR009675 TPX2_fam
PANTHERiPTHR14326 PTHR14326, 1 hit
PfamiView protein in Pfam
PF09041 Aurora-A_bind, 1 hit
PF06886 TPX2, 1 hit
PF12214 TPX2_importin, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTPX2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9ULW0
Secondary accession number(s): Q96RR5
, Q9H1R4, Q9NRA3, Q9UFN9, Q9UL00, Q9Y2M1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: February 21, 2001
Last modified: September 18, 2019
This is version 184 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again