Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 186 (18 Sep 2019)
Sequence version 2 (01 Mar 2002)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Ubiquilin-1

Gene

UBQLN1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays an important role in the regulation of different protein degradation mechanisms and pathways including ubiquitin-proteasome system (UPS), autophagy and endoplasmic reticulum-associated protein degradation (ERAD) pathway. Mediates the proteasomal targeting of misfolded or accumulated proteins for degradation by binding (via UBA domain) to their polyubiquitin chains and by interacting (via ubiquitin-like domain) with the subunits of the proteasome (PubMed:15147878). Plays a role in the ERAD pathway via its interaction with ER-localized proteins UBXN4, VCP and HERPUD1 and may form a link between the polyubiquitinated ERAD substrates and the proteasome (PubMed:19822669, PubMed:18307982). Isoform 1, isoform 2 and isoform 3 play a role in unfolded protein response (UPR) by attenuating the induction of UPR-inducible genes, DDTI3/CHOP, HSPA5 and PDIA2 during ER stress (PubMed:18953672). Involved in the regulation of macroautophagy and autophagosome formation; required for maturation of autophagy-related protein LC3 from the cytosolic form LC3-I to the membrane-bound form LC3-II and may assist in the maturation of autophagosomes to autolysosomes by mediating autophagosome-lysosome fusion (PubMed:19148225, PubMed:20529957, PubMed:23459205). Negatively regulates the TICAM1/TRIF-dependent toll-like receptor signaling pathway by decreasing the abundance of TICAM1 via the autophagic pathway (PubMed:21695056). Isoform 1 and isoform 3 play a key role in the regulation of the levels of PSEN1 by targeting its accumulation to aggresomes which may then be removed from cells by autophagocytosis (PubMed:21143716). Promotes the ubiquitination and lysosomal degradation of ORAI1, consequently downregulating the ORAI1-mediated Ca2+ mobilization (PubMed:23307288). Suppresses the maturation and proteasomal degradation of amyloid beta A4 protein (A4) by stimulating the lysine 63 (K63)-linked polyubiquitination. Delays the maturation of A4 by sequestering it in the Golgi apparatus and preventing its transport to the cell surface for subsequent processing (By similarity).1 PublicationBy similarity9 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processAutophagy

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-8856825 Cargo recognition for clathrin-mediated endocytosis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ubiquilin-1
Alternative name(s):
Protein linking IAP with cytoskeleton 1
Short name:
PLIC-1
Short name:
hPLIC-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:UBQLN1
Synonyms:DA41, PLIC1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:12508 UBQLN1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605046 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9UMX0

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoplasmic vesicle, Endoplasmic reticulum, Membrane, Nucleus, Proteasome

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
29979

Open Targets

More...
OpenTargetsi
ENSG00000135018

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA37155

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
UBQLN1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
48475013

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002110082 – 589Ubiquilin-1Add BLAST588

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Degraded during both macroautophagy and during chaperone-mediated autophagy (CMA).1 Publication
Phosphorylated.1 Publication
Ubiquitinated.1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9UMX0

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9UMX0

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9UMX0

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9UMX0

PeptideAtlas

More...
PeptideAtlasi
Q9UMX0

PRoteomics IDEntifications database

More...
PRIDEi
Q9UMX0

ProteomicsDB human proteome resource

More...
ProteomicsDBi
85215 [Q9UMX0-1]
85216 [Q9UMX0-2]

2D gel databases

REPRODUCTION-2DPAGE

More...
REPRODUCTION-2DPAGEi
IPI00071180

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9UMX0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9UMX0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Brain (at protein level) (PubMed:18953672). Ubiquitous. Highly expressed throughout the brain; detected in neurons and in neuropathological lesions, such as neurofibrillary tangles and Lewy bodies. Highly expressed in heart, placenta, pancreas, lung, liver, skeletal muscle and kidney.3 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000135018 Expressed in 209 organ(s), highest expression level in placenta

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9UMX0 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9UMX0 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB037256
HPA054143

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer and homodimer. Heterodimer with UBQLN2 (PubMed:16813565). Binds CD47, NBL1, GABRA1, GABRA2, GABRA3, GABRA6, GABRB1, GABRB2 and GABRB3 (By similarity). Binds UBE3A, BTRC, P4HB and MTOR.

Interacts with the proteasome 19S subunit.

Interacts (via ubiquitin-like domain) with TREX1; the interaction is direct and may control TREX1 subcellular location.

Forms a complex with UBXN4 and VCP.

Interacts (via UBA domain) with UBQLN4 (via ubiquitin-like domain).

Found in a complex with UBQLN2 and MAP1LC3A/B/C. The monomeric form interacts with PSEN2 and the monomeric forms of isoform 1 and isoform 3 interact with PSEN1.

Interacts with ORAI1.

Interacts (via UBA domain) with TICAM1.

Interacts with EPS15.

Interacts (via UBA domain) with UBA52 and (via ubiquitin-like domain) with PSMD3 and PSMD4.

Interacts with HERPUD1.

Interacts with MAP1LC3A/B/C in the presence of UBQLN4.

Interacts (via ubiquitin-like domain) with EPS15 (via UIM domains) and both the ubiquitinated and non-ubiquitinated forms can interact with EPS15.

Interacts (via ubiquitin-like domain) with EPS15L1, HGS (via UIM domain) and STAM2 (via UIM domain).

By similarity17 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
itself3EBI-741480,EBI-741480
Q8WU023EBI-10173939,EBI-747182
Q96FB23EBI-10173939,EBI-2857623
ACOT7O001543EBI-10173939,EBI-948905
ADRM1Q161864EBI-741480,EBI-954387
AGPAT5Q9NUQ25EBI-741480,EBI-6916385
AGR2O959947EBI-741480,EBI-712648
AGR3Q8TD063EBI-10173939,EBI-3925742
BPIFA1Q9NP553EBI-10173939,EBI-953896
C1QTNF2Q9BXJ53EBI-10173939,EBI-2817707
CALUO438523EBI-10173939,EBI-1171069
CCL7P800983EBI-10173939,EBI-718759
CD99L2Q8TCZ26EBI-10173939,EBI-2824782
CLCN2P51788-43EBI-10173939,EBI-16431116
COL10A1Q036925EBI-741480,EBI-2528309
COL1A2A0A0S2Z3K03EBI-10173939,EBI-16431143
COL1A2P081236EBI-10173939,EBI-983038
COLGALT2Q8IYK43EBI-10173939,EBI-10263496
COMTD1Q86VU53EBI-10173939,EBI-2836030
CSTF2P332406EBI-741480,EBI-711360
CSTF2TQ9H0L46EBI-741480,EBI-747012
CTAG1BP783587EBI-741480,EBI-1188472
CTAG2O756383EBI-10173939,EBI-10188927
CYB5R1Q9UHQ93EBI-10173939,EBI-953870
DEFA6Q015243EBI-10173939,EBI-10222451
DOLKA0A0S2Z5Y13EBI-741480,EBI-16431159
EFEMP2O959674EBI-741480,EBI-743414
EPS15P425665EBI-741480,EBI-396684
ERP27Q96DN03EBI-741480,EBI-953772
ETNK1Q9HBU63EBI-10173939,EBI-2834493
FCGR2AP123183EBI-741480,EBI-1395970
FKBP2P268853EBI-741480,EBI-719873
FN1P027513EBI-741480,EBI-1220319
FZD7O750843EBI-741480,EBI-746917
GABRDO147644EBI-741480,EBI-744352
GHRLQ9UBU33EBI-10173939,EBI-10319458
GPX3P223523EBI-10173939,EBI-2832946
GRM2Q144163EBI-10173939,EBI-10232876
GYPBP060286EBI-741480,EBI-10194756
HK2P527894EBI-741480,EBI-741469
HSD17B12Q53GQ03EBI-10173939,EBI-2963255
HSPA13P487237EBI-741480,EBI-750892
IGL@Q6PIK13EBI-10173939,EBI-10253735
IGL@Q6PIQ73EBI-10173939,EBI-6677651
IGL@Q8N3554EBI-741480,EBI-748681
IL6STQ17RA03EBI-10173939,EBI-10238517
IST1P539903EBI-741480,EBI-945994
ITPRIPL1Q6GPH63EBI-741480,EBI-953819
KLHL42Q9P2K63EBI-10173939,EBI-739890
LHX4A0A0S2Z5S93EBI-741480,EBI-16429099
LITAFQ997327EBI-10173939,EBI-725647
MANBALQ9NQG13EBI-10173939,EBI-3867271
MCM7P339933EBI-10173939,EBI-355924
MIEF1Q9NQG63EBI-10173939,EBI-740987
MIEF2Q96C034EBI-741480,EBI-750153
MLLT6P551983EBI-10173939,EBI-740216
NAXDQ8IW453EBI-741480,EBI-8650724
NBL1P412713EBI-10173939,EBI-10208650
NGLY1Q96IV05EBI-741480,EBI-6165879
NLGN3A0A0S2Z5K23EBI-10173939,EBI-16431177
NME3Q132325EBI-741480,EBI-713684
NPPAP011603EBI-741480,EBI-953859
NUP58Q9BVL23EBI-10173939,EBI-2811583
PAUFC3PTT63EBI-741480,EBI-3505892
PBXIP1Q96AQ63EBI-10173939,EBI-740845
PIK3IP1Q96FE73EBI-741480,EBI-10285708
PLAAT3P538166EBI-741480,EBI-746318
PNMA1Q8ND904EBI-741480,EBI-302345
PPIBP232843EBI-741480,EBI-359252
PPICP458773EBI-10173939,EBI-953909
PRAP1Q96NZ95EBI-741480,EBI-2116102
PRB1A5D9033EBI-10173939,EBI-10173935
PSMD4P550364EBI-741480,EBI-359318
PSMD6Q150083EBI-10173939,EBI-359701
RIC8AQ9NPQ83EBI-741480,EBI-717509
RIC8AQ9NPQ8-43EBI-741480,EBI-9091816
RNF208Q9H0X63EBI-741480,EBI-751555
RPN1P048433EBI-741480,EBI-355963
RSRC2Q7L4I2-23EBI-741480,EBI-10256202
RTL8AQ9BWD34EBI-741480,EBI-741643
RTL8BQ17RB05EBI-741480,EBI-10238588
RTL8CA6ZKI35EBI-741480,EBI-10174072
SCG2P135213EBI-741480,EBI-947132
SCG5P054083EBI-741480,EBI-722635
SCMH1Q96GD33EBI-10173939,EBI-713793
SERPINE1P051213EBI-741480,EBI-953978
SERPINI2O758308EBI-741480,EBI-750144
SIL1Q9H1733EBI-741480,EBI-2840325
SMIM2Q9BVW63EBI-10173939,EBI-10300146
SMR3BP028143EBI-741480,EBI-738612
SRGNP101245EBI-741480,EBI-744915
TFF1P041553EBI-741480,EBI-743871
TMCO6Q96DC75EBI-741480,EBI-746174
TMCO6Q96DC7-23EBI-10173939,EBI-10284552
TMEM31Q5JXX73EBI-10173939,EBI-10244617
TMEM67A0A0S2Z5T93EBI-10173939,EBI-16431189
TMUB2Q71RG43EBI-10173939,EBI-2820477
TRIM32Q130498EBI-741480,EBI-742790
TXNDC12O958813EBI-10173939,EBI-2564581
UBBQ5U5U63EBI-741480,EBI-1642104
UBCQ96C323EBI-741480,EBI-745483
UBE2V1Q134045EBI-741480,EBI-1050671
UBQLN4Q9NRR58EBI-741480,EBI-711226
UBXN1Q043233EBI-10173939,EBI-1058647
UBXN4Q925755EBI-741480,EBI-723441
XPO4Q0VG753EBI-741480,EBI-10226948
ZFAND2BQ8WV993EBI-10173939,EBI-747823
ZG16O608448EBI-741480,EBI-746479
ZMYM4Q5VZL53EBI-741480,EBI-2514659
ZNF343Q6P1L63EBI-741480,EBI-10252492

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
119007, 264 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q9UMX0

Database of interacting proteins

More...
DIPi
DIP-41629N

Protein interaction database and analysis system

More...
IntActi
Q9UMX0, 203 interactors

Molecular INTeraction database

More...
MINTi
Q9UMX0

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000365576

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1589
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9UMX0

Database of comparative protein structure models

More...
ModBasei
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9UMX0

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini37 – 111Ubiquitin-likePROSITE-ProRule annotationAdd BLAST75
Domaini182 – 210STI1 1Sequence analysisAdd BLAST29
Domaini212 – 251STI1 2Sequence analysisAdd BLAST40
Domaini387 – 434STI1 3Sequence analysisAdd BLAST48
Domaini438 – 470STI1 4Sequence analysisAdd BLAST33
Domaini546 – 586UBAPROSITE-ProRule annotationAdd BLAST41

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni178 – 428Interaction with UBXN41 PublicationAdd BLAST251

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The UBA domain mediates binding to PSEN1 and PSEN2. It also binds ubiquitin with micromolar affinity, independently of polyubiquitin linkage type. Essential for its association with microtubule-associated protein 1 light chain 3 (MAP1LC3).3 Publications
The ubiquitin-like domain mediates its association with the subunits of the proteasome.1 Publication
Dimerization is dependent upon the central region of the protein containing the STI1 domains and is independent of its ubiquitin-like and UBA domains.1 Publication

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0010 Eukaryota
COG5272 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156437

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9UMX0

KEGG Orthology (KO)

More...
KOi
K04523

Identification of Orthologs from Complete Genome Data

More...
OMAi
FRQMMSN

Database of Orthologous Groups

More...
OrthoDBi
1553668at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9UMX0

TreeFam database of animal gene trees

More...
TreeFami
TF314412

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR006636 STI1_HS-bd
IPR015940 UBA
IPR009060 UBA-like_sf
IPR015496 Ubiquilin
IPR029071 Ubiquitin-like_domsf
IPR000626 Ubiquitin_dom
IPR028799 UBQLN1

The PANTHER Classification System

More...
PANTHERi
PTHR10677 PTHR10677, 1 hit
PTHR10677:SF16 PTHR10677:SF16, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00627 UBA, 1 hit
PF00240 ubiquitin, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00727 STI1, 4 hits
SM00165 UBA, 1 hit
SM00213 UBQ, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF46934 SSF46934, 1 hit
SSF54236 SSF54236, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50030 UBA, 1 hit
PS50053 UBIQUITIN_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UMX0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAESGESGGP PGSQDSAAGA EGAGAPAAAA SAEPKIMKVT VKTPKEKEEF
60 70 80 90 100
AVPENSSVQQ FKEEISKRFK SHTDQLVLIF AGKILKDQDT LSQHGIHDGL
110 120 130 140 150
TVHLVIKTQN RPQDHSAQQT NTAGSNVTTS STPNSNSTSG SATSNPFGLG
160 170 180 190 200
GLGGLAGLSS LGLNTTNFSE LQSQMQRQLL SNPEMMVQIM ENPFVQSMLS
210 220 230 240 250
NPDLMRQLIM ANPQMQQLIQ RNPEISHMLN NPDIMRQTLE LARNPAMMQE
260 270 280 290 300
MMRNQDRALS NLESIPGGYN ALRRMYTDIQ EPMLSAAQEQ FGGNPFASLV
310 320 330 340 350
SNTSSGEGSQ PSRTENRDPL PNPWAPQTSQ SSSASSGTAS TVGGTTGSTA
360 370 380 390 400
SGTSGQSTTA PNLVPGVGAS MFNTPGMQSL LQQITENPQL MQNMLSAPYM
410 420 430 440 450
RSMMQSLSQN PDLAAQMMLN NPLFAGNPQL QEQMRQQLPT FLQQMQNPDT
460 470 480 490 500
LSAMSNPRAM QALLQIQQGL QTLATEAPGL IPGFTPGLGA LGSTGGSSGT
510 520 530 540 550
NGSNATPSEN TSPTAGTTEP GHQQFIQQML QALAGVNPQL QNPEVRFQQQ
560 570 580
LEQLSAMGFL NREANLQALI ATGGDINAAI ERLLGSQPS
Length:589
Mass (Da):62,519
Last modified:March 1, 2002 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i8B4756B6113B7025
GO
Isoform 2 (identifier: Q9UMX0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     417-444: Missing.

Note: No experimental confirmation available.
Show »
Length:561
Mass (Da):59,220
Checksum:i1E0BC42EC5BA4DA6
GO
Isoform 3 (identifier: Q9UMX0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     61-237: Missing.

Show »
Length:412
Mass (Da):43,038
Checksum:i61264678FFCAA699
GO
Isoform 4 (identifier: Q9UMX0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     150-181: GGLGGLAGLSSLGLNTTNFSELQSQMQRQLLS → DVGTCQESSNDAGDDEEPGPSFEQPRKHPRGI
     182-589: Missing.

Show »
Length:181
Mass (Da):18,910
Checksum:i92A3D97BF619E306
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YEZ9H0YEZ9_HUMAN
Ubiquilin-1
UBQLN1
158Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YDS0H0YDS0_HUMAN
Ubiquilin-1
UBQLN1
157Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti25A → T in AAH39294 (PubMed:15489334).Curated1
Sequence conflicti41V → A in BAB20436 (PubMed:10807547).Curated1
Sequence conflicti61F → S in BAB20436 (PubMed:10807547).Curated1
Sequence conflicti91L → S in BAB20436 (PubMed:10807547).Curated1
Sequence conflicti125S → G in CAB66578 (PubMed:11230166).Curated1
Sequence conflicti202P → H in AAH39294 (PubMed:15489334).Curated1
Sequence conflicti537 – 538NP → YS in BAB20436 (PubMed:10807547).Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_05768961 – 237Missing in isoform 3. 1 PublicationAdd BLAST177
Alternative sequenceiVSP_057690150 – 181GGLGG…RQLLS → DVGTCQESSNDAGDDEEPGP SFEQPRKHPRGI in isoform 4. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_057691182 – 589Missing in isoform 4. 1 PublicationAdd BLAST408
Alternative sequenceiVSP_009787417 – 444Missing in isoform 2. 2 PublicationsAdd BLAST28

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF176069 mRNA Translation: AAD49751.3
AF293384 mRNA Translation: AAG02473.1
AB035275 mRNA Translation: BAB20436.1
HM005532 mRNA Translation: AEE61129.1
AL136643 mRNA Translation: CAB66578.1
AL354920 Genomic DNA No translation available.
CH471089 Genomic DNA Translation: EAW62659.1
CH471089 Genomic DNA Translation: EAW62661.1
CH471089 Genomic DNA Translation: EAW62664.1
BC010066 mRNA Translation: AAH10066.1
BC039294 mRNA Translation: AAH39294.1
AK074535 mRNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS6663.1 [Q9UMX0-1]
CCDS6664.1 [Q9UMX0-2]

NCBI Reference Sequences

More...
RefSeqi
NP_038466.2, NM_013438.4 [Q9UMX0-1]
NP_444295.1, NM_053067.2 [Q9UMX0-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000257468; ENSP00000257468; ENSG00000135018 [Q9UMX0-2]
ENST00000376395; ENSP00000365576; ENSG00000135018 [Q9UMX0-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
29979

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:29979

UCSC genome browser

More...
UCSCi
uc004amv.4 human [Q9UMX0-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF176069 mRNA Translation: AAD49751.3
AF293384 mRNA Translation: AAG02473.1
AB035275 mRNA Translation: BAB20436.1
HM005532 mRNA Translation: AEE61129.1
AL136643 mRNA Translation: CAB66578.1
AL354920 Genomic DNA No translation available.
CH471089 Genomic DNA Translation: EAW62659.1
CH471089 Genomic DNA Translation: EAW62661.1
CH471089 Genomic DNA Translation: EAW62664.1
BC010066 mRNA Translation: AAH10066.1
BC039294 mRNA Translation: AAH39294.1
AK074535 mRNA No translation available.
CCDSiCCDS6663.1 [Q9UMX0-1]
CCDS6664.1 [Q9UMX0-2]
RefSeqiNP_038466.2, NM_013438.4 [Q9UMX0-1]
NP_444295.1, NM_053067.2 [Q9UMX0-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2JY5NMR-A541-586[»]
2JY6NMR-B541-586[»]
2KLCNMR-A34-112[»]
SMRiQ9UMX0
ModBaseiSearch...

Protein-protein interaction databases

BioGridi119007, 264 interactors
CORUMiQ9UMX0
DIPiDIP-41629N
IntActiQ9UMX0, 203 interactors
MINTiQ9UMX0
STRINGi9606.ENSP00000365576

PTM databases

iPTMnetiQ9UMX0
PhosphoSitePlusiQ9UMX0

Polymorphism and mutation databases

BioMutaiUBQLN1
DMDMi48475013

2D gel databases

REPRODUCTION-2DPAGEiIPI00071180

Proteomic databases

EPDiQ9UMX0
jPOSTiQ9UMX0
MassIVEiQ9UMX0
PaxDbiQ9UMX0
PeptideAtlasiQ9UMX0
PRIDEiQ9UMX0
ProteomicsDBi85215 [Q9UMX0-1]
85216 [Q9UMX0-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000257468; ENSP00000257468; ENSG00000135018 [Q9UMX0-2]
ENST00000376395; ENSP00000365576; ENSG00000135018 [Q9UMX0-1]
GeneIDi29979
KEGGihsa:29979
UCSCiuc004amv.4 human [Q9UMX0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
29979
DisGeNETi29979

GeneCards: human genes, protein and diseases

More...
GeneCardsi
UBQLN1
HGNCiHGNC:12508 UBQLN1
HPAiCAB037256
HPA054143
MIMi605046 gene
neXtProtiNX_Q9UMX0
OpenTargetsiENSG00000135018
PharmGKBiPA37155

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0010 Eukaryota
COG5272 LUCA
GeneTreeiENSGT00940000156437
InParanoidiQ9UMX0
KOiK04523
OMAiFRQMMSN
OrthoDBi1553668at2759
PhylomeDBiQ9UMX0
TreeFamiTF314412

Enzyme and pathway databases

ReactomeiR-HSA-8856825 Cargo recognition for clathrin-mediated endocytosis

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
UBQLN1 human
EvolutionaryTraceiQ9UMX0

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
UBQLN1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
29979

Pharos

More...
Pharosi
Q9UMX0

Protein Ontology

More...
PROi
PR:Q9UMX0

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000135018 Expressed in 209 organ(s), highest expression level in placenta
ExpressionAtlasiQ9UMX0 baseline and differential
GenevisibleiQ9UMX0 HS

Family and domain databases

InterProiView protein in InterPro
IPR006636 STI1_HS-bd
IPR015940 UBA
IPR009060 UBA-like_sf
IPR015496 Ubiquilin
IPR029071 Ubiquitin-like_domsf
IPR000626 Ubiquitin_dom
IPR028799 UBQLN1
PANTHERiPTHR10677 PTHR10677, 1 hit
PTHR10677:SF16 PTHR10677:SF16, 1 hit
PfamiView protein in Pfam
PF00627 UBA, 1 hit
PF00240 ubiquitin, 1 hit
SMARTiView protein in SMART
SM00727 STI1, 4 hits
SM00165 UBA, 1 hit
SM00213 UBQ, 1 hit
SUPFAMiSSF46934 SSF46934, 1 hit
SSF54236 SSF54236, 1 hit
PROSITEiView protein in PROSITE
PS50030 UBA, 1 hit
PS50053 UBIQUITIN_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiUBQL1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UMX0
Secondary accession number(s): A0A024R284
, Q5T6J5, Q5T6J9, Q8IXS9, Q8N2Q3, Q9H0T8, Q9H3R4, Q9HAZ5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 29, 2004
Last sequence update: March 1, 2002
Last modified: September 18, 2019
This is version 186 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again