Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 162 (16 Oct 2019)
Sequence version 1 (01 May 2000)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Sorting nexin-7

Gene

SNX7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be involved in several stages of intracellular trafficking.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei73Phosphatidylinositol 3-phosphateBy similarity1
Binding sitei99Phosphatidylinositol 3-phosphateBy similarity1
Binding sitei108Phosphatidylinositol 3-phosphateBy similarity1
Binding sitei117Phosphatidylinositol 3-phosphateBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processProtein transport, Transport
LigandLipid-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sorting nexin-7
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SNX7
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:14971 SNX7

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
614904 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9UNH6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasmic vesicle, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
51375

Open Targets

More...
OpenTargetsi
ENSG00000162627

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA37947

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9UNH6

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SNX7

Domain mapping of disease mutations (DMDM)

More...
DMDMi
12643904

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002138481 – 387Sorting nexin-7Add BLAST387

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9UNH6

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9UNH6

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9UNH6

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9UNH6

PeptideAtlas

More...
PeptideAtlasi
Q9UNH6

PRoteomics IDEntifications database

More...
PRIDEi
Q9UNH6

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
85293 [Q9UNH6-1]
85294 [Q9UNH6-2]
85295 [Q9UNH6-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9UNH6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9UNH6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000162627 Expressed in 219 organ(s), highest expression level in neocortex

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9UNH6 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9UNH6 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA037419
HPA054338

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
119508, 11 interactors

Protein interaction database and analysis system

More...
IntActi
Q9UNH6, 20 interactors

Molecular INTeraction database

More...
MINTi
Q9UNH6

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000304429

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1387
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9UNH6

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9UNH6

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini30 – 151PXPROSITE-ProRule annotationAdd BLAST122

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the sorting nexin family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2273 Eukaryota
COG5391 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155315

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9UNH6

KEGG Orthology (KO)

More...
KOi
K17921

Identification of Orthologs from Complete Genome Data

More...
OMAi
KIAHRIY

Database of Orthologous Groups

More...
OrthoDBi
990775at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9UNH6

TreeFam database of animal gene trees

More...
TreeFami
TF328543

Family and domain databases

Conserved Domains Database

More...
CDDi
cd07666 BAR_SNX7, 1 hit
cd07284 PX_SNX7, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.1270.60, 1 hit
3.30.1520.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR027267 AH/BAR_dom_sf
IPR042131 BAR_SNX7
IPR001683 Phox
IPR036871 PX_dom_sf
IPR042130 PX_SNX7
IPR028656 SNX7

The PANTHER Classification System

More...
PANTHERi
PTHR45949:SF3 PTHR45949:SF3, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00787 PX, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00312 PX, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF64268 SSF64268, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50195 PX, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9UNH6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDMNSFSPMM PTSPLSMINQ IKFEDEPDLK DLFITVDEPE SHVTTIETFI
60 70 80 90 100
TYRIITKTSR GEFDSSEFEV RRRYQDFLWL KGKLEEAHPT LIIPPLPEKF
110 120 130 140 150
IVKGMVERFN DDFIETRRKA LHKFLNRIAD HPTLTFNEDF KIFLTAQAWE
160 170 180 190 200
LSSHKKQGPG LLSRMGQTVR AVASSMRGVK NRPEEFMEMN NFIELFSQKI
210 220 230 240 250
NLIDKISQRI YKEEREYFDE MKEYGPIHIL WSASEEDLVD TLKDVASCID
260 270 280 290 300
RCCKATEKRM SGLSEALLPV VHEYVLYSEM LMGVMKRRDQ IQAELDSKVE
310 320 330 340 350
VLTYKKADTD LLPEEIGKLE DKVECANNAL KADWERWKQN MQNDIKLAFT
360 370 380
DMAEENIHYY EQCLATWESF LTSQTNLHLE EASEDKP
Length:387
Mass (Da):45,303
Last modified:May 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE703B3EC6013DC1F
GO
Isoform 2 (identifier: Q9UNH6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     312-362: Missing.

Show »
Length:336
Mass (Da):39,207
Checksum:iAAE0BE2FA7BF4616
GO
Isoform 3 (identifier: Q9UNH6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEGERRASQAPSSGLPAGGANGESPGGGAPFPGSSGSSALLQAEVLDLDEDEDDLEVFSKDASLM

Show »
Length:451
Mass (Da):51,619
Checksum:i9BCBE544F8C3AAA4
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PNL2E9PNL2_HUMAN
Sorting nexin-7
SNX7
396Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B7ZC83B7ZC83_HUMAN
Sorting nexin-7
SNX7
108Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PLE1E9PLE1_HUMAN
Sorting nexin-7
SNX7
36Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAD27830 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAD96949 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti59S → T in BAD96949 (PubMed:14702039).Curated1
Sequence conflicti105M → I in CAB43229 (PubMed:17974005).Curated1
Sequence conflicti108 – 109RF → PG in CN483413 (Ref. 8) Curated2
Sequence conflicti153S → P in AAH10349 (PubMed:15489334).Curated1
Sequence conflicti165M → T in CAB43229 (PubMed:17974005).Curated1
Sequence conflicti199K → R in BAD96949 (PubMed:14702039).Curated1
Sequence conflicti324E → G in CAB43229 (PubMed:17974005).Curated1
Sequence conflicti370F → L in CAB43229 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_057331186F → L. Corresponds to variant dbSNP:rs35391040Ensembl.1
Natural variantiVAR_057332278S → N. Corresponds to variant dbSNP:rs12033678Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0390441M → MEGERRASQAPSSGLPAGGA NGESPGGGAPFPGSSGSSAL LQAEVLDLDEDEDDLEVFSK DASLM in isoform 3. 1 Publication1
Alternative sequenceiVSP_006191312 – 362Missing in isoform 2. 2 PublicationsAdd BLAST51

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
BT006747 mRNA Translation: AAP35393.1
AK223229 mRNA Translation: BAD96949.1 Different initiation.
AK293018 mRNA Translation: BAF85707.1
AL627442 Genomic DNA No translation available.
CH471097 Genomic DNA Translation: EAW72995.1
CH471097 Genomic DNA Translation: EAW72996.1
CH471097 Genomic DNA Translation: EAW72997.1
CH471097 Genomic DNA Translation: EAW72998.1
BC010349 mRNA Translation: AAH10349.1
BC018105 mRNA Translation: AAH18105.1
AF121857 mRNA Translation: AAD27830.1 Different initiation.
AL049989 mRNA Translation: CAB43229.1
CN483413 mRNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS755.2 [Q9UNH6-3]

NCBI Reference Sequences

More...
RefSeqi
NP_057060.2, NM_015976.4 [Q9UNH6-3]
NP_689424.2, NM_152238.3
XP_006710741.1, XM_006710678.2
XP_011539866.1, XM_011541564.2 [Q9UNH6-1]
XP_016856914.1, XM_017001425.1 [Q9UNH6-1]
XP_016856915.1, XM_017001426.1 [Q9UNH6-1]
XP_016856916.1, XM_017001427.1 [Q9UNH6-1]
XP_016856917.1, XM_017001428.1 [Q9UNH6-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000306121; ENSP00000304429; ENSG00000162627 [Q9UNH6-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
51375

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:51375

UCSC genome browser

More...
UCSCi
uc010ouc.3 human [Q9UNH6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BT006747 mRNA Translation: AAP35393.1
AK223229 mRNA Translation: BAD96949.1 Different initiation.
AK293018 mRNA Translation: BAF85707.1
AL627442 Genomic DNA No translation available.
CH471097 Genomic DNA Translation: EAW72995.1
CH471097 Genomic DNA Translation: EAW72996.1
CH471097 Genomic DNA Translation: EAW72997.1
CH471097 Genomic DNA Translation: EAW72998.1
BC010349 mRNA Translation: AAH10349.1
BC018105 mRNA Translation: AAH18105.1
AF121857 mRNA Translation: AAD27830.1 Different initiation.
AL049989 mRNA Translation: CAB43229.1
CN483413 mRNA No translation available.
CCDSiCCDS755.2 [Q9UNH6-3]
RefSeqiNP_057060.2, NM_015976.4 [Q9UNH6-3]
NP_689424.2, NM_152238.3
XP_006710741.1, XM_006710678.2
XP_011539866.1, XM_011541564.2 [Q9UNH6-1]
XP_016856914.1, XM_017001425.1 [Q9UNH6-1]
XP_016856915.1, XM_017001426.1 [Q9UNH6-1]
XP_016856916.1, XM_017001427.1 [Q9UNH6-1]
XP_016856917.1, XM_017001428.1 [Q9UNH6-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3IQ2X-ray1.70A/B25-154[»]
SMRiQ9UNH6
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi119508, 11 interactors
IntActiQ9UNH6, 20 interactors
MINTiQ9UNH6
STRINGi9606.ENSP00000304429

PTM databases

iPTMnetiQ9UNH6
PhosphoSitePlusiQ9UNH6

Polymorphism and mutation databases

BioMutaiSNX7
DMDMi12643904

Proteomic databases

EPDiQ9UNH6
jPOSTiQ9UNH6
MassIVEiQ9UNH6
PaxDbiQ9UNH6
PeptideAtlasiQ9UNH6
PRIDEiQ9UNH6
ProteomicsDBi85293 [Q9UNH6-1]
85294 [Q9UNH6-2]
85295 [Q9UNH6-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
51375

Genome annotation databases

EnsembliENST00000306121; ENSP00000304429; ENSG00000162627 [Q9UNH6-3]
GeneIDi51375
KEGGihsa:51375
UCSCiuc010ouc.3 human [Q9UNH6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
51375
DisGeNETi51375

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SNX7
HGNCiHGNC:14971 SNX7
HPAiHPA037419
HPA054338
MIMi614904 gene
neXtProtiNX_Q9UNH6
OpenTargetsiENSG00000162627
PharmGKBiPA37947

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2273 Eukaryota
COG5391 LUCA
GeneTreeiENSGT00940000155315
InParanoidiQ9UNH6
KOiK17921
OMAiKIAHRIY
OrthoDBi990775at2759
PhylomeDBiQ9UNH6
TreeFamiTF328543

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SNX7 human
EvolutionaryTraceiQ9UNH6

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
51375
PharosiQ9UNH6

Protein Ontology

More...
PROi
PR:Q9UNH6

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000162627 Expressed in 219 organ(s), highest expression level in neocortex
ExpressionAtlasiQ9UNH6 baseline and differential
GenevisibleiQ9UNH6 HS

Family and domain databases

CDDicd07666 BAR_SNX7, 1 hit
cd07284 PX_SNX7, 1 hit
Gene3Di1.20.1270.60, 1 hit
3.30.1520.10, 1 hit
InterProiView protein in InterPro
IPR027267 AH/BAR_dom_sf
IPR042131 BAR_SNX7
IPR001683 Phox
IPR036871 PX_dom_sf
IPR042130 PX_SNX7
IPR028656 SNX7
PANTHERiPTHR45949:SF3 PTHR45949:SF3, 1 hit
PfamiView protein in Pfam
PF00787 PX, 1 hit
SMARTiView protein in SMART
SM00312 PX, 1 hit
SUPFAMiSSF64268 SSF64268, 1 hit
PROSITEiView protein in PROSITE
PS50195 PX, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSNX7_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9UNH6
Secondary accession number(s): A8KAF3
, D3DT50, Q53FQ3, Q5VT09, Q5VT10, Q86U82, Q8WVD4, Q96FW9, Q9Y3Z7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: May 1, 2000
Last modified: October 16, 2019
This is version 162 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again