Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 151 (16 Oct 2019)
Sequence version 3 (05 Oct 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Angiomotin-like protein 2

Gene

AMOTL2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regulates the translocation of phosphorylated SRC to peripheral cell-matrix adhesion sites. Required for proper architecture of actin filaments. Inhibits the Wnt/beta-catenin signaling pathway, probably by recruiting CTNNB1 to recycling endosomes and hence preventing its translocation to the nucleus. Participates in angiogenesis. May play a role in the polarity, proliferation and migration of endothelial cells. Selectively promotes FGF-induced MAPK activation through SRC.3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processWnt signaling pathway

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2028269 Signaling by Hippo

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Angiomotin-like protein 2
Alternative name(s):
Leman coiled-coil protein
Short name:
LCCP
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:AMOTL2
Synonyms:KIAA0989
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:17812 AMOTL2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
614658 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9Y2J4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Endosome

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
51421

Open Targets

More...
OpenTargetsi
ENSG00000114019

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA24775

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9Y2J4

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
AMOTL2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
308153633

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001906721 – 779Angiomotin-like protein 2Add BLAST779

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei107Phosphotyrosine; by FGFR1By similarity1
Modified residuei759PhosphoserineCombined sources1
Modified residuei762PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylation at Tyr-107 is necessary for efficient binding to SRC and synergistically functioning with SRC to activate the downstream MAPK pathway.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9Y2J4

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9Y2J4

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9Y2J4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9Y2J4

PeptideAtlas

More...
PeptideAtlasi
Q9Y2J4

PRoteomics IDEntifications database

More...
PRIDEi
Q9Y2J4

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
20614
85814 [Q9Y2J4-1]
85815 [Q9Y2J4-2]
85816 [Q9Y2J4-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9Y2J4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9Y2J4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000114019 Expressed in 236 organ(s), highest expression level in mammary gland

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9Y2J4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9Y2J4 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA063027

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with SRC.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
119530, 102 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q9Y2J4

Database of interacting proteins

More...
DIPi
DIP-57510N

Protein interaction database and analysis system

More...
IntActi
Q9Y2J4, 116 interactors

Molecular INTeraction database

More...
MINTi
Q9Y2J4

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000424765

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9Y2J4

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili308 – 581Sequence analysisAdd BLAST274

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi776 – 779PDZ-binding4

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the angiomotin family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IEF3 Eukaryota
ENOG410ZEXZ LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156577

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000233789

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9Y2J4

KEGG Orthology (KO)

More...
KOi
K06104

Identification of Orthologs from Complete Genome Data

More...
OMAi
HAKHGSK

Database of Orthologous Groups

More...
OrthoDBi
369983at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9Y2J4

TreeFam database of animal gene trees

More...
TreeFami
TF333368

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR009114 Angiomotin
IPR024646 Angiomotin_C

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12240 Angiomotin_C, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01807 ANGIOMOTIN

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9Y2J4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRTLEDSSGT VLHRLIQEQL RYGNLTETRT LLAIQQQALR GGAGTGGTGS
60 70 80 90 100
PQASLEILAP EDSQVLQQAT RQEPQGQEHQ GGENHLAENT LYRLCPQPSK
110 120 130 140 150
GEELPTYEEA KAHSQYYAAQ QAGTRPHAGD RDPRGAPGGS RRQDEALREL
160 170 180 190 200
RHGHVRSLSE RLLQLSLERN GARAPSHMSS SHSFPQLARN QQGPPLRGPP
210 220 230 240 250
AEGPESRGPP PQYPHVVLAH ETTTAVTDPR YRARGSPHFQ HAEVRILQAQ
260 270 280 290 300
VPPVFLQQQQ QYQYLQQSQE HPPPPHPAAL GHGPLSSLSP PAVEGPVSAQ
310 320 330 340 350
ASSATSGSAH LAQMEAVLRE NARLQRDNER LQRELESSAE KAGRIEKLES
360 370 380 390 400
EIQRLSEAHE SLTRASSKRE ALEKTMRNKM DSEMRRLQDF NRDLRERLES
410 420 430 440 450
ANRRLASKTQ EAQAGSQDMV AKLLAQSYEQ QQEQEKLERE MALLRGAIED
460 470 480 490 500
QRRRAELLEQ ALGNAQGRAA RAEEELRKKQ AYVEKVERLQ QALGQLQAAC
510 520 530 540 550
EKREQLELRL RTRLEQELKA LRAQQRQAGA PGGSSGSGGS PELSALRLSE
560 570 580 590 600
QLREKEEQIL ALEADMTKWE QKYLEERAMR QFAMDAAATA AAQRDTTLIR
610 620 630 640 650
HSPQPSPSSS FNEGLLTGGH RHQEMESRLK VLHAQILEKD AVIKVLQQRS
660 670 680 690 700
RRDPGKAIQG SLRPAKSVPS VFAAAAAGTQ GWQGLSSSER QTADAPARLT
710 720 730 740 750
TDRAPTEEPV VTAPPAAHAK HGSRDGSTQT EGPPDSTSTC LPPEPDSLLG
760 770
CSSSQRAASL DSVATSRVQD LSDMVEILI
Length:779
Mass (Da):85,764
Last modified:October 5, 2010 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i665BE69FD7757CEF
GO
Isoform 2 (identifier: Q9Y2J4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     701-701: T → TA

Show »
Length:780
Mass (Da):85,835
Checksum:iBC8B569E10247B01
GO
Isoform 3 (identifier: Q9Y2J4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     525-526: Missing.

Note: No experimental confirmation available.
Show »
Length:777
Mass (Da):85,480
Checksum:i0B454D787F017544
GO
Isoform 4 (identifier: Q9Y2J4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTGRKASGGTPCTLRKGAPIITLGKNWTERLAAGDSVGCSGARCHRPLSRQLCASQRSM

Note: No experimental confirmation available.
Show »
Length:837
Mass (Da):91,817
Checksum:i18CC1B88CF34F90A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RCL7D6RCL7_HUMAN
Angiomotin-like protein 2
AMOTL2
198Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RBK2D6RBK2_HUMAN
Angiomotin-like protein 2
AMOTL2
127Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RF61D6RF61_HUMAN
Angiomotin-like protein 2
AMOTL2
151Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RIC7D6RIC7_HUMAN
Angiomotin-like protein 2
AMOTL2
123Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RJA4D6RJA4_HUMAN
Angiomotin-like protein 2
AMOTL2
144Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RFG0D6RFG0_HUMAN
Angiomotin-like protein 2
AMOTL2
33Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH11454 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAA76833 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence BAD97318 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti666K → E in BAH12987 (PubMed:14702039).Curated1
Sequence conflicti680Q → K in AAD56361 (PubMed:12406577).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_055497227T → I. Corresponds to variant dbSNP:rs35377537Ensembl.1
Natural variantiVAR_055498342A → P. Corresponds to variant dbSNP:rs2303635Ensembl.1
Natural variantiVAR_055499415G → S. Corresponds to variant dbSNP:rs2241559Ensembl.1
Natural variantiVAR_023535731E → D4 PublicationsCorresponds to variant dbSNP:rs1353776Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0440811M → MTGRKASGGTPCTLRKGAPI ITLGKNWTERLAAGDSVGCS GARCHRPLSRQLCASQRSM in isoform 4. 1 Publication1
Alternative sequenceiVSP_037826525 – 526Missing in isoform 3. 1 Publication2
Alternative sequenceiVSP_015711701T → TA in isoform 2. 2 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB023206 mRNA Translation: BAA76833.1 Different initiation.
AK291616 mRNA Translation: BAF84305.1
AK299270 mRNA Translation: BAH12987.1
AK223598 mRNA Translation: BAD97318.1 Different initiation.
AF175966 mRNA Translation: AAD56361.2
AC010207 Genomic DNA No translation available.
BC011454 mRNA Translation: AAH11454.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS33860.1 [Q9Y2J4-2]
CCDS63783.1 [Q9Y2J4-3]
CCDS63784.1 [Q9Y2J4-4]
CCDS87138.1 [Q9Y2J4-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001265612.1, NM_001278683.1 [Q9Y2J4-4]
NP_001265614.1, NM_001278685.1 [Q9Y2J4-3]
NP_057285.3, NM_016201.3 [Q9Y2J4-2]
XP_006713717.1, XM_006713654.2 [Q9Y2J4-1]
XP_011511183.1, XM_011512881.1
XP_016862069.1, XM_017006580.1 [Q9Y2J4-2]
XP_016862070.1, XM_017006581.1 [Q9Y2J4-2]
XP_016862071.1, XM_017006582.1 [Q9Y2J4-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000249883; ENSP00000249883; ENSG00000114019 [Q9Y2J4-2]
ENST00000422605; ENSP00000409999; ENSG00000114019 [Q9Y2J4-1]
ENST00000513145; ENSP00000425475; ENSG00000114019 [Q9Y2J4-3]
ENST00000514516; ENSP00000424765; ENSG00000114019 [Q9Y2J4-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
51421

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:51421

UCSC genome browser

More...
UCSCi
uc003eqf.4 human [Q9Y2J4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB023206 mRNA Translation: BAA76833.1 Different initiation.
AK291616 mRNA Translation: BAF84305.1
AK299270 mRNA Translation: BAH12987.1
AK223598 mRNA Translation: BAD97318.1 Different initiation.
AF175966 mRNA Translation: AAD56361.2
AC010207 Genomic DNA No translation available.
BC011454 mRNA Translation: AAH11454.1 Different initiation.
CCDSiCCDS33860.1 [Q9Y2J4-2]
CCDS63783.1 [Q9Y2J4-3]
CCDS63784.1 [Q9Y2J4-4]
CCDS87138.1 [Q9Y2J4-1]
RefSeqiNP_001265612.1, NM_001278683.1 [Q9Y2J4-4]
NP_001265614.1, NM_001278685.1 [Q9Y2J4-3]
NP_057285.3, NM_016201.3 [Q9Y2J4-2]
XP_006713717.1, XM_006713654.2 [Q9Y2J4-1]
XP_011511183.1, XM_011512881.1
XP_016862069.1, XM_017006580.1 [Q9Y2J4-2]
XP_016862070.1, XM_017006581.1 [Q9Y2J4-2]
XP_016862071.1, XM_017006582.1 [Q9Y2J4-2]

3D structure databases

SMRiQ9Y2J4
ModBaseiSearch...

Protein-protein interaction databases

BioGridi119530, 102 interactors
CORUMiQ9Y2J4
DIPiDIP-57510N
IntActiQ9Y2J4, 116 interactors
MINTiQ9Y2J4
STRINGi9606.ENSP00000424765

PTM databases

iPTMnetiQ9Y2J4
PhosphoSitePlusiQ9Y2J4

Polymorphism and mutation databases

BioMutaiAMOTL2
DMDMi308153633

Proteomic databases

EPDiQ9Y2J4
jPOSTiQ9Y2J4
MassIVEiQ9Y2J4
PaxDbiQ9Y2J4
PeptideAtlasiQ9Y2J4
PRIDEiQ9Y2J4
ProteomicsDBi20614
85814 [Q9Y2J4-1]
85815 [Q9Y2J4-2]
85816 [Q9Y2J4-3]

Genome annotation databases

EnsembliENST00000249883; ENSP00000249883; ENSG00000114019 [Q9Y2J4-2]
ENST00000422605; ENSP00000409999; ENSG00000114019 [Q9Y2J4-1]
ENST00000513145; ENSP00000425475; ENSG00000114019 [Q9Y2J4-3]
ENST00000514516; ENSP00000424765; ENSG00000114019 [Q9Y2J4-4]
GeneIDi51421
KEGGihsa:51421
UCSCiuc003eqf.4 human [Q9Y2J4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
51421
DisGeNETi51421

GeneCards: human genes, protein and diseases

More...
GeneCardsi
AMOTL2
HGNCiHGNC:17812 AMOTL2
HPAiHPA063027
MIMi614658 gene
neXtProtiNX_Q9Y2J4
OpenTargetsiENSG00000114019
PharmGKBiPA24775

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IEF3 Eukaryota
ENOG410ZEXZ LUCA
GeneTreeiENSGT00940000156577
HOGENOMiHOG000233789
InParanoidiQ9Y2J4
KOiK06104
OMAiHAKHGSK
OrthoDBi369983at2759
PhylomeDBiQ9Y2J4
TreeFamiTF333368

Enzyme and pathway databases

ReactomeiR-HSA-2028269 Signaling by Hippo

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
AMOTL2 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
AMOTL2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
51421
PharosiQ9Y2J4

Protein Ontology

More...
PROi
PR:Q9Y2J4

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000114019 Expressed in 236 organ(s), highest expression level in mammary gland
ExpressionAtlasiQ9Y2J4 baseline and differential
GenevisibleiQ9Y2J4 HS

Family and domain databases

InterProiView protein in InterPro
IPR009114 Angiomotin
IPR024646 Angiomotin_C
PfamiView protein in Pfam
PF12240 Angiomotin_C, 1 hit
PRINTSiPR01807 ANGIOMOTIN

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiAMOL2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Y2J4
Secondary accession number(s): A8K6F1
, B7Z5Q1, E9PHW3, Q53EP1, Q96F99, Q9UKB4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 27, 2005
Last sequence update: October 5, 2010
Last modified: October 16, 2019
This is version 151 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again