Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 162 (08 May 2019)
Sequence version 3 (30 Nov 2010)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Glutamate receptor-interacting protein 1

Gene

GRIP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play a role as a localized scaffold for the assembly of a multiprotein signaling complex and as mediator of the trafficking of its binding partners at specific subcellular location in neurons (PubMed:10197531). Through complex formation with NSG1, GRIA2 and STX12 controls the intracellular fate of AMPAR and the endosomal sorting of the GRIA2 subunit toward recycling and membrane targeting (By similarity).By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-416993 Trafficking of GluR2-containing AMPA receptors

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q9Y3R0

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q9Y3R0

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Glutamate receptor-interacting protein 1
Short name:
GRIP-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:GRIP1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:18708 GRIP1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
604597 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9Y3R0

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasmic vesicle, Endoplasmic reticulum, Membrane, Postsynaptic cell membrane, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Fraser syndrome 3 (FRASRS3)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of Fraser syndrome, an autosomal recessive disorder characterized by cryptophthalmos, cutaneous syndactyly, and urogenital abnormalities including renal agenesis or hypoplasia. Additional features include abnormalities of the larynx, ear malformations, and facial abnormalities.
See also OMIM:617667

Organism-specific databases

DisGeNET

More...
DisGeNETi
23426

MalaCards human disease database

More...
MalaCardsi
GRIP1
MIMi617667 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000155974

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
2052 Fraser syndrome

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
GRIP1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
313104231

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000838491 – 1128Glutamate receptor-interacting protein 1Add BLAST1128

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei43PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9Y3R0

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9Y3R0

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9Y3R0

PeptideAtlas

More...
PeptideAtlasi
Q9Y3R0

PRoteomics IDEntifications database

More...
PRIDEi
Q9Y3R0

ProteomicsDB human proteome resource

More...
ProteomicsDBi
86065
86066 [Q9Y3R0-2]
86067 [Q9Y3R0-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9Y3R0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9Y3R0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000155974 Expressed in 153 organ(s), highest expression level in neocortex

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9Y3R0 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9Y3R0 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA038856

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with EPHA7, EPHB2, KIF5A, KIF5B, KIF5C, GRIA2, GRIA3, GRIPAP1/GRASP1, PPFIA1, PPFIA4, FRAS1, PLCD4, PTPRF and liprins-alpha. Can form homomultimers or heteromultimers with GRIP2. Forms a ternary complex with GRIA2 and CSPG4 (By similarity). Interacts with ATAD1 in an ATP-dependent manner. ATAD1-catalyzed ATP hydrolysis disrupts binding to ATAD1 and to GRIA2 and leads to AMPAR complex disassembly (By similarity). Interacts with EFNB1, EFNB3 and the C-terminal tail of PRLHR. Interacts with SLC30A9 (By similarity). Interacts with BUD23. Forms a complex with NSG1, GRIA2 and STX12; controls the intracellular fate of AMPAR and the endosomal sorting of the GRIA2 subunit toward recycling and membrane targeting. Interacts with NSG1 (By similarity).By similarity3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116995, 45 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q9Y3R0

Protein interaction database and analysis system

More...
IntActi
Q9Y3R0, 22 interactors

Molecular INTeraction database

More...
MINTi
Q9Y3R0

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000381098

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11128
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2JILX-ray1.50A/B149-239[»]

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9Y3R0

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9Y3R0

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini53 – 136PDZ 1PROSITE-ProRule annotationAdd BLAST84
Domaini150 – 238PDZ 2PROSITE-ProRule annotationAdd BLAST89
Domaini252 – 336PDZ 3PROSITE-ProRule annotationAdd BLAST85
Domaini472 – 561PDZ 4PROSITE-ProRule annotationAdd BLAST90
Domaini573 – 658PDZ 5PROSITE-ProRule annotationAdd BLAST86
Domaini673 – 755PDZ 6PROSITE-ProRule annotationAdd BLAST83
Domaini1004 – 1086PDZ 7PROSITE-ProRule annotationAdd BLAST83

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

PDZ 6 mediates interaction with the PDZ recognition motif of EFNB1 and EPHB2 and with the C-terminus of PPFIA1 and PPFIA4. PDZ 4 and PDZ 5 mediate interaction with the C-terminus of GRIA2 and GRIA3. PDZ 4, PDZ 5 and PDZ 6 mediate homomultimers. PDZ 7 mediates interaction with PDZ domain of GRASP1. PDZ 7 domain binds CSPG4. PDZ 6 mediates interaction with the C-terminus of liprins-alpha. PDZ 1, PDZ 2 and PDZ 3 mediate interaction with the PDZ-binding motif of FRAS1 (By similarity). PDZ 4 and PDZ 5 mediate interaction with PRLHR.By similarity

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3528 Eukaryota
ENOG410XSUX LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158692

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000043120

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9Y3R0

KEGG Orthology (KO)

More...
KOi
K20251

Identification of Orthologs from Complete Genome Data

More...
OMAi
DHCRMPA

Database of Orthologous Groups

More...
OrthoDBi
65191at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9Y3R0

TreeFam database of animal gene trees

More...
TreeFami
TF326909

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR030026 GRIP1
IPR001478 PDZ
IPR041489 PDZ_6
IPR036034 PDZ_sf

The PANTHER Classification System

More...
PANTHERi
PTHR46227:SF3 PTHR46227:SF3, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00595 PDZ, 6 hits
PF17820 PDZ_6, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00228 PDZ, 7 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50156 SSF50156, 7 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50106 PDZ, 7 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 13 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9Y3R0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MIAVSFKCRC QILRRLTKDE SPYTKSASQT KPPDGALAVR RQSIPEEFKG
60 70 80 90 100
STVVELMKKE GTTLGLTVSG GIDKDGKPRV SNLRQGGIAA RSDQLDVGDY
110 120 130 140 150
IKAVNGINLA KFRHDEIISL LKNVGERVVL EVEYELPPVS VQGSSVIFRT
160 170 180 190 200
VEVTLHKEGN TFGFVIRGGA HDDRNKSRPV VITCVRPGGP ADREGTIKPG
210 220 230 240 250
DRLLSVDGIR LLGTTHAEAM SILKQCGQEA ALLIEYDVSV MDSVATASGP
260 270 280 290 300
LLVEVAKTPG ASLGVALTTS MCCNKQVIVI DKIKSASIAD RCGALHVGDH
310 320 330 340 350
ILSIDGTSME YCTLAEATQF LANTTDQVKL EILPHHQTRL ALKGPDHVKI
360 370 380 390 400
QRSDRQLTWD SWASNHSSLH TNHHYNTYHP DHCRVPALTF PKAPPPNSPP
410 420 430 440 450
ALVSSSFSPT SMSAYSLSSL NMGTLPRSLY STSPRGTMMR RRLKKKDFKS
460 470 480 490 500
SLSLASSTVG LAGQVVHTET TEVVLTADPV TGFGIQLQGS VFATETLSSP
510 520 530 540 550
PLISYIEADS PAERCGVLQI GDRVMAINGI PTEDSTFEEA SQLLRDSSIT
560 570 580 590 600
SKVTLEIEFD VAESVIPSSG TFHVKLPKKH NVELGITISS PSSRKPGDPL
610 620 630 640 650
VISDIKKGSV AHRTGTLELG DKLLAIDNIR LDNCSMEDAV QILQQCEDLV
660 670 680 690 700
KLKIRKDEDN SDEQESSGAI IYTVELKRYG GPLGITISGT EEPFDPIIIS
710 720 730 740 750
SLTKGGLAER TGAIHIGDRI LAINSSSLKG KPLSEAIHLL QMAGETVTLK
760 770 780 790 800
IKKQTDAQSA SSPKKFPISS HLSDLGDVEE DSSPAQKPGK LSDMYPSTVP
810 820 830 840 850
SVDSAVDSWD GSAIDTSYGT QGTSFQASGY NFNTYDWRSP KQRGSLSPVT
860 870 880 890 900
KPRSQTYPDV GLSYEDWDRS TASGFAGAAD SAETEQEENF WSQALEDLET
910 920 930 940 950
CGQSGILREL EEKADRRVSL RNMTLLATIM SGSTMSLNHE APTPRSQLGR
960 970 980 990 1000
QASFQERSSS RPHYSQTTRS NTLPSDVGRK SVTLRKMKQE IKEIMSPTPV
1010 1020 1030 1040 1050
ELHKVTLYKD SDMEDFGFSV ADGLLEKGVY VKNIRPAGPG DLGGLKPYDR
1060 1070 1080 1090 1100
LLQVNHVRTR DFDCCLVVPL IAESGNKLDL VISRNPLASQ KSIDQQSLPG
1110 1120
DWSEQNSAFF QQPSHGGNLE TREPTNTL
Length:1,128
Mass (Da):122,422
Last modified:November 30, 2010 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD97B96ADF2C3796B
GO
Isoform 2 (identifier: Q9Y3R0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     912-926: Missing.

Note: No experimental confirmation available.
Show »
Length:1,113
Mass (Da):120,638
Checksum:i238CCE7D74B02257
GO
Isoform 3 (identifier: Q9Y3R0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     348-400: VKIQRSDRQLTWDSWASNHSSLHTNHHYNTYHPDHCRVPALTFPKAPPPNSPP → A

Show »
Length:1,076
Mass (Da):116,371
Checksum:iE5A5A1C1EAD662C6
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 13 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5H4P8F5H4P8_HUMAN
Glutamate receptor-interacting prot...
GRIP1
876Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H3G9F5H3G9_HUMAN
Glutamate receptor-interacting prot...
GRIP1
188Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H4N6F5H4N6_HUMAN
Glutamate receptor-interacting prot...
GRIP1
1,056Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H4Q7F5H4Q7_HUMAN
Glutamate receptor-interacting prot...
GRIP1
787Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H5I0F5H5I0_HUMAN
Glutamate receptor-interacting prot...
GRIP1
120Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YFK8H0YFK8_HUMAN
Glutamate receptor-interacting prot...
GRIP1
928Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H424F5H424_HUMAN
Glutamate receptor-interacting prot...
GRIP1
149Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YGF1H0YGF1_HUMAN
Glutamate receptor-interacting prot...
GRIP1
121Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YGM4H0YGM4_HUMAN
Glutamate receptor-interacting prot...
GRIP1
283Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H3F9F5H3F9_HUMAN
Glutamate receptor-interacting prot...
GRIP1
210Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti821Q → E in AAI15394 (PubMed:15489334).Curated1
Sequence conflicti821Q → E in CAB39895 (PubMed:10197531).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_056904322A → T. Corresponds to variant dbSNP:rs17102531EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_040281348 – 400VKIQR…PNSPP → A in isoform 3. 1 PublicationAdd BLAST53
Alternative sequenceiVSP_009743912 – 926Missing in isoform 2. 1 PublicationAdd BLAST15

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AC078889 Genomic DNA No translation available.
AC090710 Genomic DNA No translation available.
AC122686 Genomic DNA No translation available.
AC135251 Genomic DNA No translation available.
BC115393 mRNA Translation: AAI15394.1
BC115394 mRNA Translation: AAI15395.1
AJ133439 mRNA Translation: CAB39895.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS41807.1 [Q9Y3R0-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001171545.1, NM_001178074.1
NP_066973.2, NM_021150.3 [Q9Y3R0-3]
XP_011536395.1, XM_011538093.2

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000359742; ENSP00000352780; ENSG00000155974 [Q9Y3R0-1]
ENST00000398016; ENSP00000381098; ENSG00000155974 [Q9Y3R0-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
23426

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:23426

UCSC genome browser

More...
UCSCi
uc001stk.4 human [Q9Y3R0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC078889 Genomic DNA No translation available.
AC090710 Genomic DNA No translation available.
AC122686 Genomic DNA No translation available.
AC135251 Genomic DNA No translation available.
BC115393 mRNA Translation: AAI15394.1
BC115394 mRNA Translation: AAI15395.1
AJ133439 mRNA Translation: CAB39895.1
CCDSiCCDS41807.1 [Q9Y3R0-3]
RefSeqiNP_001171545.1, NM_001178074.1
NP_066973.2, NM_021150.3 [Q9Y3R0-3]
XP_011536395.1, XM_011538093.2

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2JILX-ray1.50A/B149-239[»]
SMRiQ9Y3R0
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116995, 45 interactors
CORUMiQ9Y3R0
IntActiQ9Y3R0, 22 interactors
MINTiQ9Y3R0
STRINGi9606.ENSP00000381098

PTM databases

iPTMnetiQ9Y3R0
PhosphoSitePlusiQ9Y3R0

Polymorphism and mutation databases

BioMutaiGRIP1
DMDMi313104231

Proteomic databases

EPDiQ9Y3R0
jPOSTiQ9Y3R0
PaxDbiQ9Y3R0
PeptideAtlasiQ9Y3R0
PRIDEiQ9Y3R0
ProteomicsDBi86065
86066 [Q9Y3R0-2]
86067 [Q9Y3R0-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000359742; ENSP00000352780; ENSG00000155974 [Q9Y3R0-1]
ENST00000398016; ENSP00000381098; ENSG00000155974 [Q9Y3R0-3]
GeneIDi23426
KEGGihsa:23426
UCSCiuc001stk.4 human [Q9Y3R0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23426
DisGeNETi23426

GeneCards: human genes, protein and diseases

More...
GeneCardsi
GRIP1
HGNCiHGNC:18708 GRIP1
HPAiHPA038856
MalaCardsiGRIP1
MIMi604597 gene
617667 phenotype
neXtProtiNX_Q9Y3R0
OpenTargetsiENSG00000155974
Orphaneti2052 Fraser syndrome

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3528 Eukaryota
ENOG410XSUX LUCA
GeneTreeiENSGT00940000158692
HOGENOMiHOG000043120
InParanoidiQ9Y3R0
KOiK20251
OMAiDHCRMPA
OrthoDBi65191at2759
PhylomeDBiQ9Y3R0
TreeFamiTF326909

Enzyme and pathway databases

ReactomeiR-HSA-416993 Trafficking of GluR2-containing AMPA receptors
SignaLinkiQ9Y3R0
SIGNORiQ9Y3R0

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
GRIP1 human
EvolutionaryTraceiQ9Y3R0

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
GRIP1_(gene)

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
23426

Protein Ontology

More...
PROi
PR:Q9Y3R0

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000155974 Expressed in 153 organ(s), highest expression level in neocortex
ExpressionAtlasiQ9Y3R0 baseline and differential
GenevisibleiQ9Y3R0 HS

Family and domain databases

InterProiView protein in InterPro
IPR030026 GRIP1
IPR001478 PDZ
IPR041489 PDZ_6
IPR036034 PDZ_sf
PANTHERiPTHR46227:SF3 PTHR46227:SF3, 1 hit
PfamiView protein in Pfam
PF00595 PDZ, 6 hits
PF17820 PDZ_6, 1 hit
SMARTiView protein in SMART
SM00228 PDZ, 7 hits
SUPFAMiSSF50156 SSF50156, 7 hits
PROSITEiView protein in PROSITE
PS50106 PDZ, 7 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiGRIP1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Y3R0
Secondary accession number(s): C9JT59, Q1RLM0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 29, 2004
Last sequence update: November 30, 2010
Last modified: May 8, 2019
This is version 162 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again