Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 160 (18 Sep 2019)
Sequence version 1 (01 Nov 1999)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Meiotic recombination protein SPO11

Gene

SPO11

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Component of a topoisomerase 6 complex specifically required for meiotic recombination. Together with TOP6BL, mediates DNA cleavage that forms the double-strand breaks (DSB) that initiate meiotic recombination. The complex promotes relaxation of negative and positive supercoiled DNA and DNA decatenation through cleavage and ligation cycles. Essential for the phosphorylation of SMC3, HORMAD1 and HORMAD2.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • ATP-dependent breakage, passage and rejoining of double-stranded DNA.Curated EC:5.6.2.2

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei138NucleophileBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi224MagnesiumBy similarity1
Metal bindingi277MagnesiumBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding, Hydrolase, Isomerase
Biological processMeiosis
LigandMagnesium, Metal-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-912446 Meiotic recombination

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Meiotic recombination protein SPO11 (EC:5.6.2.2Curated)
Alternative name(s):
Cancer/testis antigen 35
Short name:
CT35
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SPO11
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 20

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:11250 SPO11

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605114 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9Y5K1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
23626

Open Targets

More...
OpenTargetsi
ENSG00000054796

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA36080

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9Y5K1

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SPO11

Domain mapping of disease mutations (DMDM)

More...
DMDMi
7674367

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001454741 – 396Meiotic recombination protein SPO11Add BLAST396

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9Y5K1

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9Y5K1

PeptideAtlas

More...
PeptideAtlasi
Q9Y5K1

PRoteomics IDEntifications database

More...
PRIDEi
Q9Y5K1

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
86424 [Q9Y5K1-1]
86425 [Q9Y5K1-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9Y5K1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9Y5K1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in testis.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000054796 Expressed in 14 organ(s), highest expression level in female gonad

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9Y5K1 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9Y5K1 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterotetramer of SPO11 and 2 TOP6BL chains.

Interacts with TOP6BL.

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
117158, 2 interactors

Protein interaction database and analysis system

More...
IntActi
Q9Y5K1, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000360310

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9Y5K1

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TOP6A family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2795 Eukaryota
COG1697 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000001787

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000225930

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9Y5K1

KEGG Orthology (KO)

More...
KOi
K10878

Identification of Orthologs from Complete Genome Data

More...
OMAi
FTDGDPY

Database of Orthologous Groups

More...
OrthoDBi
1272299at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9Y5K1

TreeFam database of animal gene trees

More...
TreeFami
TF314157

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00223 TOPRIM_TopoIIB_SPO, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.10.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR004084 Meiosis_Spo11
IPR013048 Meiotic_Spo11
IPR002815 Spo11/TopoVI_A
IPR013049 Spo11/TopoVI_A_N
IPR036078 Spo11/TopoVI_A_sf
IPR034136 TOPRIM_Topo6A/Spo11
IPR036388 WH-like_DNA-bd_sf

The PANTHER Classification System

More...
PANTHERi
PTHR10848 PTHR10848, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03533 SPO11_like, 1 hit
PF04406 TP6A_N, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01551 SPO11HOMOLOG
PR01550 TOP6AFAMILY

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56726 SSF56726, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9Y5K1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAFAPMGPEA SFFDVLDRHR ESLLAALRRG GREPPTGGSR LASSSEVLAS
60 70 80 90 100
IENIIQDIIT SLARNEAPAF TIDNRSSWEN IKFEDSVGLQ MVSHCTTRKI
110 120 130 140 150
KSDSPKSAQK FSLILKILSM IYKLVQSNTY ATKRDIYYTD SQLFGNQTVV
160 170 180 190 200
DNIINDISCM LKVSRRSLHI LSTSKGLIAG NLRYIEEDGT KVNCTCGATA
210 220 230 240 250
VAVPSNIQGI RNLVTDAKFV LIVEKDATFQ RLLDDNFCNK LSPCIMITGK
260 270 280 290 300
GVPDLNTRLL VKKLWDTFHV PVFTLVDADP HGIEIMCIYK YGSMSMSFEA
310 320 330 340 350
HHLTVPAIRW LGLLPSDLKR LNVPKDSLIP LTKRDQMKLD SILRRPYVTC
360 370 380 390
QPFWRKEMEI MADSKMKAEI QALTFLSSDY LSRVYLPNKL KFGGWI
Length:396
Mass (Da):44,537
Last modified:November 1, 1999 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i117A93D1E7BEBEC8
GO
Isoform 2 (identifier: Q9Y5K1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     44-82: SSEVLASIENIIQDIITSLARNEAPAFTIDNRSSWENIK → R

Note: No experimental confirmation available.
Show »
Length:358
Mass (Da):40,364
Checksum:i0277826777623625
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5TCH6Q5TCH6_HUMAN
Meiotic recombination protein SPO11
SPO11
270Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5TCH7Q5TCH7_HUMAN
Meiotic recombination protein SPO11
SPO11
354Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YCK9H0YCK9_HUMAN
Meiotic recombination protein SPO11
SPO11
123Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02330736T → A1 PublicationCorresponds to variant dbSNP:rs28368062Ensembl.1
Natural variantiVAR_05259691M → V. Corresponds to variant dbSNP:rs3736832Ensembl.1
Natural variantiVAR_052597202A → V. Corresponds to variant dbSNP:rs17406460Ensembl.1
Natural variantiVAR_029246211R → W. Corresponds to variant dbSNP:rs28368082Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_00653344 – 82SSEVL…WENIK → R in isoform 2. 1 PublicationAdd BLAST39

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF149310 mRNA Translation: AAD44812.1
AF169385 mRNA Translation: AAD52562.1
AY957583 Genomic DNA Translation: AAX44047.1
AL135939 Genomic DNA No translation available.
BC033591 mRNA Translation: AAH33591.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS13456.1 [Q9Y5K1-1]
CCDS13457.1 [Q9Y5K1-2]

NCBI Reference Sequences

More...
RefSeqi
NP_036576.1, NM_012444.2 [Q9Y5K1-1]
NP_937998.1, NM_198265.1 [Q9Y5K1-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000345868; ENSP00000316034; ENSG00000054796 [Q9Y5K1-2]
ENST00000371263; ENSP00000360310; ENSG00000054796 [Q9Y5K1-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
23626

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:23626

UCSC genome browser

More...
UCSCi
uc002xye.4 human [Q9Y5K1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF149310 mRNA Translation: AAD44812.1
AF169385 mRNA Translation: AAD52562.1
AY957583 Genomic DNA Translation: AAX44047.1
AL135939 Genomic DNA No translation available.
BC033591 mRNA Translation: AAH33591.1
CCDSiCCDS13456.1 [Q9Y5K1-1]
CCDS13457.1 [Q9Y5K1-2]
RefSeqiNP_036576.1, NM_012444.2 [Q9Y5K1-1]
NP_937998.1, NM_198265.1 [Q9Y5K1-2]

3D structure databases

SMRiQ9Y5K1
ModBaseiSearch...

Protein-protein interaction databases

BioGridi117158, 2 interactors
IntActiQ9Y5K1, 1 interactor
STRINGi9606.ENSP00000360310

PTM databases

iPTMnetiQ9Y5K1
PhosphoSitePlusiQ9Y5K1

Polymorphism and mutation databases

BioMutaiSPO11
DMDMi7674367

Proteomic databases

MassIVEiQ9Y5K1
PaxDbiQ9Y5K1
PeptideAtlasiQ9Y5K1
PRIDEiQ9Y5K1
ProteomicsDBi86424 [Q9Y5K1-1]
86425 [Q9Y5K1-2]

Genome annotation databases

EnsembliENST00000345868; ENSP00000316034; ENSG00000054796 [Q9Y5K1-2]
ENST00000371263; ENSP00000360310; ENSG00000054796 [Q9Y5K1-1]
GeneIDi23626
KEGGihsa:23626
UCSCiuc002xye.4 human [Q9Y5K1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23626
DisGeNETi23626

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SPO11
HGNCiHGNC:11250 SPO11
MIMi605114 gene
neXtProtiNX_Q9Y5K1
OpenTargetsiENSG00000054796
PharmGKBiPA36080

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2795 Eukaryota
COG1697 LUCA
GeneTreeiENSGT00390000001787
HOGENOMiHOG000225930
InParanoidiQ9Y5K1
KOiK10878
OMAiFTDGDPY
OrthoDBi1272299at2759
PhylomeDBiQ9Y5K1
TreeFamiTF314157

Enzyme and pathway databases

ReactomeiR-HSA-912446 Meiotic recombination

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
23626
PharosiQ9Y5K1

Protein Ontology

More...
PROi
PR:Q9Y5K1

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000054796 Expressed in 14 organ(s), highest expression level in female gonad
ExpressionAtlasiQ9Y5K1 baseline and differential
GenevisibleiQ9Y5K1 HS

Family and domain databases

CDDicd00223 TOPRIM_TopoIIB_SPO, 1 hit
Gene3Di1.10.10.10, 1 hit
InterProiView protein in InterPro
IPR004084 Meiosis_Spo11
IPR013048 Meiotic_Spo11
IPR002815 Spo11/TopoVI_A
IPR013049 Spo11/TopoVI_A_N
IPR036078 Spo11/TopoVI_A_sf
IPR034136 TOPRIM_Topo6A/Spo11
IPR036388 WH-like_DNA-bd_sf
PANTHERiPTHR10848 PTHR10848, 1 hit
PfamiView protein in Pfam
PF03533 SPO11_like, 1 hit
PF04406 TP6A_N, 1 hit
PRINTSiPR01551 SPO11HOMOLOG
PR01550 TOP6AFAMILY
SUPFAMiSSF56726 SSF56726, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSPO11_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Y5K1
Secondary accession number(s): Q5TCI1
, Q8N4V0, Q9NQM7, Q9NQM8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: November 1, 1999
Last modified: September 18, 2019
This is version 160 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again