Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 174 (05 Jun 2019)
Sequence version 2 (27 Jul 2011)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1

Gene

Plcb1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.By similarity

Miscellaneous

The receptor-mediated activation of PLC-beta-1 is mediated by two G-protein alpha subunits, alpha-Q and alpha-11.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Ca2+By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei331PROSITE-ProRule annotation1
Active sitei378PROSITE-ProRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Transducer
Biological processLipid degradation, Lipid metabolism
LigandCalcium

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
3.1.4.11 3474

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-112043 PLC beta mediated events
R-MMU-1855204 Synthesis of IP3 and IP4 in the cytosol
R-MMU-399997 Acetylcholine regulates insulin secretion
R-MMU-4086398 Ca2+ pathway
R-MMU-416476 G alpha (q) signalling events
R-MMU-418217 G beta:gamma signalling through PLC beta
R-MMU-434316 Fatty Acids bound to GPR40 (FFAR1) regulate insulin secretion
R-MMU-500657 Presynaptic function of Kainate receptors

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 (EC:3.1.4.11)
Alternative name(s):
PLC-154
Phosphoinositide phospholipase C-beta-1
Phospholipase C-beta-1
Short name:
PLC-beta-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Plcb1
Synonyms:Plcb
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:97613 Plcb1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Membrane, Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000884871 – 12161-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1Add BLAST1216

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei236PhosphoserineCombined sources1
Modified residuei417PhosphoserineCombined sources1
Modified residuei509PhosphothreonineCombined sources1
Modified residuei511PhosphoserineCombined sources1
Modified residuei582PhosphoserineCombined sources1
Modified residuei887Phosphoserine; by PKCBy similarity1
Modified residuei978PhosphoserineCombined sources1
Modified residuei987PhosphoserineCombined sources1
Modified residuei1197PhosphoserineCombined sources1
Modified residuei1199PhosphoserineCombined sources1
Modified residuei1200PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9Z1B3

PeptideAtlas

More...
PeptideAtlasi
Q9Z1B3

PRoteomics IDEntifications database

More...
PRIDEi
Q9Z1B3

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9Z1B3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9Z1B3

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q9Z1B3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000051177 Expressed in 285 organ(s), highest expression level in dorsal striatum

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9Z1B3 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9Z1B3 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with DGKQ.

By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
202232, 3 interactors

Protein interaction database and analysis system

More...
IntActi
Q9Z1B3, 5 interactors

Molecular INTeraction database

More...
MINTi
Q9Z1B3

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000105743

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9Z1B3

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini316 – 467PI-PLC X-boxPROSITE-ProRule annotationAdd BLAST152
Domaini540 – 656PI-PLC Y-boxPROSITE-ProRule annotationAdd BLAST117
Domaini663 – 761C2PROSITE-ProRule annotationAdd BLAST99

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi914 – 1088Lys-richAdd BLAST175

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0169 Eukaryota
ENOG410XPSW LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155428

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9Z1B3

KEGG Orthology (KO)

More...
KOi
K05858

Identification of Orthologs from Complete Genome Data

More...
OMAi
DSEMTQK

Database of Orthologous Groups

More...
OrthoDBi
368239at2759

TreeFam database of animal gene trees

More...
TreeFami
TF313216

Family and domain databases

Conserved Domains Database

More...
CDDi
cd13361 PH_PLC_beta, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.150, 1 hit
3.20.20.190, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000008 C2_dom
IPR035892 C2_domain_sf
IPR011992 EF-hand-dom_pair
IPR001192 PI-PLC_fam
IPR016280 PLC-beta
IPR028400 PLC-beta1
IPR014815 PLC-beta_C
IPR009535 PLC-beta_CS
IPR037862 PLC-beta_PH
IPR017946 PLC-like_Pdiesterase_TIM-brl
IPR015359 PLC_EF-hand-like
IPR000909 PLipase_C_PInositol-sp_X_dom
IPR001711 PLipase_C_Pinositol-sp_Y

The PANTHER Classification System

More...
PANTHERi
PTHR10336 PTHR10336, 1 hit
PTHR10336:SF12 PTHR10336:SF12, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF06631 DUF1154, 1 hit
PF09279 EF-hand_like, 1 hit
PF17787 PH_14, 1 hit
PF00388 PI-PLC-X, 1 hit
PF00387 PI-PLC-Y, 1 hit
PF08703 PLC-beta_C, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF000956 PLC-beta, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00390 PHPHLIPASEC

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00239 C2, 1 hit
SM00148 PLCXc, 1 hit
SM00149 PLCYc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47473 SSF47473, 1 hit
SSF51695 SSF51695, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50004 C2, 1 hit
PS50007 PIPLC_X_DOMAIN, 1 hit
PS50008 PIPLC_Y_DOMAIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform A (identifier: Q9Z1B3-1) [UniParc]FASTAAdd to basket
Also known as: C-beta-1a

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGAQPGVHA LQLKPVCVSD SLKKGTKFVK WDDDSTIVTP IILRTDPQGF
60 70 80 90 100
FFYWTDQNKE TELLDLSLVK DARCGKHAKA PKDPKLRELL DVGNIGHLEQ
110 120 130 140 150
RMITVVYGPD LVNISHLNLV AFQEEVAKEW TNEVFSLATN LLAQNMSRDA
160 170 180 190 200
FLEKAYTKLK LQVTPEGRIP LKNIYRLFSA DRKRVETALE ACSLPSSRND
210 220 230 240 250
SIPQEDFTPD VYRVFLNNLC PRPEIDNIFS EFGAKSKPYL TVDQMMDFIN
260 270 280 290 300
LKQRDPRLNE ILYPPLKQEQ VQVLIEKYEP NSSLAKKGQM SVDGFMRYLS
310 320 330 340 350
GEENGVVSPE KLDLNEDMSQ PLSHYFINSS HNTYLTAGQL AGNSSVEMYR
360 370 380 390 400
QVLLSGCRCV ELDCWKGRTA EEEPVITHGF TMTTEISFKE VIEAIAECAF
410 420 430 440 450
KTSPFPILLS FENHVDSPKQ QAKMAEYCRL IFGDALLMEP LEKYPLESGV
460 470 480 490 500
PLPSPMDLMY KILVKNKKKS HKSSEGSGKK KLSEQASNTY SDSSSVFEPS
510 520 530 540 550
SPGAGEADTE SDDDDDDDDC KKSSMDEGTA GSEAMATEEM SNLVNYIQPV
560 570 580 590 600
KFESFEISKK RNKSFEMSSF VETKGLEQLT KSPVEFVEYN KMQLSRIYPK
610 620 630 640 650
GTRVDSSNYM PQLFWNAGCQ MVALNFQTVD LAMQINMGMY EYNGKSGYRL
660 670 680 690 700
KPEFMRRPDK HFDPFTEGIV DGIVANTLSV KIISGQFLSD KKVGTYVEVD
710 720 730 740 750
MFGLPVDTRR KAFKTKTSQG NAVNPVWEEE PIVFKKVVLP SLACLRIAAY
760 770 780 790 800
EEGGKFIGHR ILPVQAIRPG YHYICLRNER NQPLTLPAVF VYIEVKDYVP
810 820 830 840 850
DTYADVIEAL SNPIRYVNLM EQRAKQLAAL TLEDEEEVKK EADPGETSSE
860 870 880 890 900
APSETRTTPA ENGVNHTASL APKPPSQAPH SQPAPGSVKA PAKTEDLIQS
910 920 930 940 950
VLTEVEAQTI EELKQQKSFV KLQKKHYKEM KDLVKRHHKK TTELIKEHTT
960 970 980 990 1000
KYNEIQNDYL RRRAALEKSA KKDSKKKSEP SSPDHGSSAI EQDLAALDAE
1010 1020 1030 1040 1050
MTQKLIDLKD KQQQQLLNLR QEQYYSEKYQ KREHIKLLIQ KLTDVAEECQ
1060 1070 1080 1090 1100
NNQLKKLKEI CEKEKKELKK KMDKKRQEKI TEAKSKDKSQ MEEEKTEMIR
1110 1120 1130 1140 1150
SYIQEVVQYI KRLEEAQSKR QEKLVEKHNE IRQQILDEKP KLQTELEQEY
1160 1170 1180 1190 1200
QDKFKRLPLE ILEFVQEAMK GKISEDSNHG SAPPSLASDA AKVNLKSPSS
1210
EEIERENPGR EFDTPL
Length:1,216
Mass (Da):138,396
Last modified:July 27, 2011 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCC751D49895A47D0
GO
Isoform B (identifier: Q9Z1B3-2) [UniParc]FASTAAdd to basket
Also known as: C-beta-1b

The sequence of this isoform differs from the canonical sequence as follows:
     1142-1216: LQTELEQEYQ...NPGREFDTPL → GEGPSSVLSEGCHEDPSVPPNFTPPNPQALKW

Show »
Length:1,173
Mass (Da):133,327
Checksum:i5AA8EEB1FCED1D93
GO
Isoform C (identifier: Q9Z1B3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1199-1216: Missing.

Note: No experimental confirmation available.
Show »
Length:1,198
Mass (Da):136,309
Checksum:iE95E5F34E58C48CA
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0J9YUY5A0A0J9YUY5_MOUSE
1-phosphatidylinositol 4,5-bisphosp...
Plcb1
59Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti28F → L in AAD00571 (Ref. 1) Curated1
Sequence conflicti28F → L in AAD00572 (Ref. 1) Curated1
Sequence conflicti28F → L in AAD00573 (Ref. 1) Curated1
Sequence conflicti41I → T in AAD00571 (Ref. 1) Curated1
Sequence conflicti41I → T in AAD00572 (Ref. 1) Curated1
Sequence conflicti41I → T in AAD00573 (Ref. 1) Curated1
Sequence conflicti67S → T in AAD01749 (PubMed:9753089).Curated1
Sequence conflicti79K → E in AAD00571 (Ref. 1) Curated1
Sequence conflicti79K → E in AAD00572 (Ref. 1) Curated1
Sequence conflicti79K → E in AAD00573 (Ref. 1) Curated1
Sequence conflicti112V → A in AAD00571 (Ref. 1) Curated1
Sequence conflicti112V → A in AAD00572 (Ref. 1) Curated1
Sequence conflicti112V → A in AAD00573 (Ref. 1) Curated1
Sequence conflicti561R → I in CAA64637 (PubMed:8687404).Curated1
Sequence conflicti613L → I in CAA64637 (PubMed:8687404).Curated1
Sequence conflicti622V → M in AAD00571 (Ref. 1) Curated1
Sequence conflicti622V → M in AAD00572 (Ref. 1) Curated1
Sequence conflicti622V → M in AAD00573 (Ref. 1) Curated1
Sequence conflicti714K → T in AAD00571 (Ref. 1) Curated1
Sequence conflicti714K → T in AAD00572 (Ref. 1) Curated1
Sequence conflicti714K → T in AAD00573 (Ref. 1) Curated1
Sequence conflicti795V → D in AAD00571 (Ref. 1) Curated1
Sequence conflicti795V → D in AAD00572 (Ref. 1) Curated1
Sequence conflicti795V → D in AAD00573 (Ref. 1) Curated1
Sequence conflicti923Q → H in AAD00571 (Ref. 1) Curated1
Sequence conflicti923Q → H in AAD00572 (Ref. 1) Curated1
Sequence conflicti923Q → H in AAD00573 (Ref. 1) Curated1
Sequence conflicti957N → I in AAD00571 (Ref. 1) Curated1
Sequence conflicti957N → I in AAD00572 (Ref. 1) Curated1
Sequence conflicti957N → I in AAD00573 (Ref. 1) Curated1
Sequence conflicti1084K → T in AAD00571 (Ref. 1) Curated1
Sequence conflicti1084K → T in AAD00572 (Ref. 1) Curated1
Sequence conflicti1084K → T in AAD00573 (Ref. 1) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0089171142 – 1216LQTEL…FDTPL → GEGPSSVLSEGCHEDPSVPP NFTPPNPQALKW in isoform B. 1 PublicationAdd BLAST75
Alternative sequenceiVSP_0089181199 – 1216Missing in isoform C. 1 PublicationAdd BLAST18

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U85712 mRNA Translation: AAD00571.1
U85713 mRNA Translation: AAD00572.1
U85714 mRNA Translation: AAD00573.1
AF498249 mRNA Translation: AAM22966.1
AF498250 mRNA Translation: AAM22967.1
AL840635 Genomic DNA No translation available.
AL928635 Genomic DNA No translation available.
AL928956 Genomic DNA No translation available.
AL935278 Genomic DNA No translation available.
BC058710 mRNA Translation: AAH58710.1
AF022801 mRNA Translation: AAD01749.1
X95344 mRNA Translation: CAA64637.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS16787.1 [Q9Z1B3-2]
CCDS50729.1 [Q9Z1B3-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
S68256

NCBI Reference Sequences

More...
RefSeqi
NP_001139302.1, NM_001145830.1 [Q9Z1B3-1]
NP_062651.2, NM_019677.2 [Q9Z1B3-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000070724; ENSMUSP00000064844; ENSMUSG00000051177 [Q9Z1B3-2]
ENSMUST00000110116; ENSMUSP00000105743; ENSMUSG00000051177 [Q9Z1B3-1]
ENSMUST00000131552; ENSMUSP00000118756; ENSMUSG00000051177 [Q9Z1B3-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
18795

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:18795

UCSC genome browser

More...
UCSCi
uc008mnx.2 mouse [Q9Z1B3-2]
uc008mny.2 mouse [Q9Z1B3-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U85712 mRNA Translation: AAD00571.1
U85713 mRNA Translation: AAD00572.1
U85714 mRNA Translation: AAD00573.1
AF498249 mRNA Translation: AAM22966.1
AF498250 mRNA Translation: AAM22967.1
AL840635 Genomic DNA No translation available.
AL928635 Genomic DNA No translation available.
AL928956 Genomic DNA No translation available.
AL935278 Genomic DNA No translation available.
BC058710 mRNA Translation: AAH58710.1
AF022801 mRNA Translation: AAD01749.1
X95344 mRNA Translation: CAA64637.1
CCDSiCCDS16787.1 [Q9Z1B3-2]
CCDS50729.1 [Q9Z1B3-1]
PIRiS68256
RefSeqiNP_001139302.1, NM_001145830.1 [Q9Z1B3-1]
NP_062651.2, NM_019677.2 [Q9Z1B3-2]

3D structure databases

SMRiQ9Z1B3
ModBaseiSearch...

Protein-protein interaction databases

BioGridi202232, 3 interactors
IntActiQ9Z1B3, 5 interactors
MINTiQ9Z1B3
STRINGi10090.ENSMUSP00000105743

PTM databases

iPTMnetiQ9Z1B3
PhosphoSitePlusiQ9Z1B3
SwissPalmiQ9Z1B3

Proteomic databases

PaxDbiQ9Z1B3
PeptideAtlasiQ9Z1B3
PRIDEiQ9Z1B3

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000070724; ENSMUSP00000064844; ENSMUSG00000051177 [Q9Z1B3-2]
ENSMUST00000110116; ENSMUSP00000105743; ENSMUSG00000051177 [Q9Z1B3-1]
ENSMUST00000131552; ENSMUSP00000118756; ENSMUSG00000051177 [Q9Z1B3-2]
GeneIDi18795
KEGGimmu:18795
UCSCiuc008mnx.2 mouse [Q9Z1B3-2]
uc008mny.2 mouse [Q9Z1B3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23236
MGIiMGI:97613 Plcb1

Phylogenomic databases

eggNOGiKOG0169 Eukaryota
ENOG410XPSW LUCA
GeneTreeiENSGT00940000155428
InParanoidiQ9Z1B3
KOiK05858
OMAiDSEMTQK
OrthoDBi368239at2759
TreeFamiTF313216

Enzyme and pathway databases

BRENDAi3.1.4.11 3474
ReactomeiR-MMU-112043 PLC beta mediated events
R-MMU-1855204 Synthesis of IP3 and IP4 in the cytosol
R-MMU-399997 Acetylcholine regulates insulin secretion
R-MMU-4086398 Ca2+ pathway
R-MMU-416476 G alpha (q) signalling events
R-MMU-418217 G beta:gamma signalling through PLC beta
R-MMU-434316 Fatty Acids bound to GPR40 (FFAR1) regulate insulin secretion
R-MMU-500657 Presynaptic function of Kainate receptors

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Plcb1 mouse

Protein Ontology

More...
PROi
PR:Q9Z1B3

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000051177 Expressed in 285 organ(s), highest expression level in dorsal striatum
ExpressionAtlasiQ9Z1B3 baseline and differential
GenevisibleiQ9Z1B3 MM

Family and domain databases

CDDicd13361 PH_PLC_beta, 1 hit
Gene3Di2.60.40.150, 1 hit
3.20.20.190, 2 hits
InterProiView protein in InterPro
IPR000008 C2_dom
IPR035892 C2_domain_sf
IPR011992 EF-hand-dom_pair
IPR001192 PI-PLC_fam
IPR016280 PLC-beta
IPR028400 PLC-beta1
IPR014815 PLC-beta_C
IPR009535 PLC-beta_CS
IPR037862 PLC-beta_PH
IPR017946 PLC-like_Pdiesterase_TIM-brl
IPR015359 PLC_EF-hand-like
IPR000909 PLipase_C_PInositol-sp_X_dom
IPR001711 PLipase_C_Pinositol-sp_Y
PANTHERiPTHR10336 PTHR10336, 1 hit
PTHR10336:SF12 PTHR10336:SF12, 1 hit
PfamiView protein in Pfam
PF06631 DUF1154, 1 hit
PF09279 EF-hand_like, 1 hit
PF17787 PH_14, 1 hit
PF00388 PI-PLC-X, 1 hit
PF00387 PI-PLC-Y, 1 hit
PF08703 PLC-beta_C, 1 hit
PIRSFiPIRSF000956 PLC-beta, 1 hit
PRINTSiPR00390 PHPHLIPASEC
SMARTiView protein in SMART
SM00239 C2, 1 hit
SM00148 PLCXc, 1 hit
SM00149 PLCYc, 1 hit
SUPFAMiSSF47473 SSF47473, 1 hit
SSF51695 SSF51695, 1 hit
PROSITEiView protein in PROSITE
PS50004 C2, 1 hit
PS50007 PIPLC_X_DOMAIN, 1 hit
PS50008 PIPLC_Y_DOMAIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPLCB1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Z1B3
Secondary accession number(s): Q62075
, Q6PDH1, Q8K5A5, Q8K5A6, Q9Z0E5, Q9Z2T5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 14, 2003
Last sequence update: July 27, 2011
Last modified: June 5, 2019
This is version 174 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again