Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_A0A024QZ92 SH2-B homolog, isoform CRA_a n=2 Tax=Homo sapiens TaxID=9606 RepID=A0A024QZ92_HUMAN MNGAPSPEDGASPSSPPLPPPPPPSWREFCESHARAAALDFARRFRLYLASHPQYAGPGA EAAFSRRFAELFLQHFEAEVARASGSLSPPILAPLSPGAEISPHDLSLESCRVGGPLAVL GPSRSSEDLAGPLPSSVSSSSTTSSKPKLKKRFSLRSVGRSVRGSVRGILQWRGTVDPPS SAGPLETSSGPPVLGGNSNSNSSGGAGTVGRGLVSDGTSPGERWTHRFERLRLSRGGGAL KDGAGMVQREELLSFMGAEEAAPDPAGVGRGGGVAGPPSGGGGQPQWQKCRLLLRSEGEG GGGSRLEFFVPPKASRPRLSIPCSSITDVRTTTALEMPDRENTFVVKVEGPSEYIMETVD AQHVKAWVSDIQECLSPGPCPATSPRPMTLPLAPGTSFLTRENTDSLELSCLNHSESLPS QDLLLGPSESNDRLSQGAYGGLSDRPSASISPSSASIAASHFDSMELLPPELPPRIPIEE GPPTGTVHPLSAPYPPLDTPETATGSFLFQGEPEGGEGDQPLSGYPWFHGMLSRLKAAQL VLTGGTGSHGVFLVRQSETRRGEYVLTFNFQGKAKHLRLSLNEEGQCRVQHLWFQSIFDM LEHFRVHPIPLESGGSSDVVLVSYVPSSQRQQGEQSRSAGEEVPVHPRSEAGSRLGAMRG CAREMDATPMPPAPSCPSERVTV

Members

Expand cluster to 90% or 50% identity.
1 to 2 of 2  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A024QZ92A0A024QZ92_HUMANSH2-B homolog, isoform CRA_aHomo sapiens (Human)9606683Representative & Seed
Q9NRF2-3Isoform 3 of SH2B1_HUMAN3, GammaHomo sapiens (Human)9606683

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A024QZ92

Checksumi: 353155178527B5A7

FASTA68372,188
        10         20         30         40         50
MNGAPSPEDG ASPSSPPLPP PPPPSWREFC ESHARAAALD FARRFRLYLA
60 70 80 90 100
SHPQYAGPGA EAAFSRRFAE LFLQHFEAEV ARASGSLSPP ILAPLSPGAE
110 120 130 140 150
ISPHDLSLES CRVGGPLAVL GPSRSSEDLA GPLPSSVSSS STTSSKPKLK
160 170 180 190 200
KRFSLRSVGR SVRGSVRGIL QWRGTVDPPS SAGPLETSSG PPVLGGNSNS
210 220 230 240 250
NSSGGAGTVG RGLVSDGTSP GERWTHRFER LRLSRGGGAL KDGAGMVQRE
260 270 280 290 300
ELLSFMGAEE AAPDPAGVGR GGGVAGPPSG GGGQPQWQKC RLLLRSEGEG
310 320 330 340 350
GGGSRLEFFV PPKASRPRLS IPCSSITDVR TTTALEMPDR ENTFVVKVEG
360 370 380 390 400
PSEYIMETVD AQHVKAWVSD IQECLSPGPC PATSPRPMTL PLAPGTSFLT
410 420 430 440 450
RENTDSLELS CLNHSESLPS QDLLLGPSES NDRLSQGAYG GLSDRPSASI
460 470 480 490 500
SPSSASIAAS HFDSMELLPP ELPPRIPIEE GPPTGTVHPL SAPYPPLDTP
510 520 530 540 550
ETATGSFLFQ GEPEGGEGDQ PLSGYPWFHG MLSRLKAAQL VLTGGTGSHG
560 570 580 590 600
VFLVRQSETR RGEYVLTFNF QGKAKHLRLS LNEEGQCRVQ HLWFQSIFDM
610 620 630 640 650
LEHFRVHPIP LESGGSSDVV LVSYVPSSQR QQGEQSRSAG EEVPVHPRSE
660 670 680
AGSRLGAMRG CAREMDATPM PPAPSCPSER VTV
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again