Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_A0A024R1J9 Neurofibromin 2 (Bilateral acoustic neuroma), isoform CRA_e n=10 Tax=Catarrhini TaxID=9526 RepID=A0A024R1J9_HUMAN MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETW FFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFL QVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMT PEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALG LHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLC IGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREKQMREEAERTRDELERRL LQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQKAAEAEQEMQRIKATAIRTE EEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDLQEAREAERRAKQKLLEIATKPT YPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLN ELKTEIEALKLKERETALDILHNENSDRGGSSKHNTIKKPQAQGRRPICI

Members

Expand cluster to 90% or 50% identity.
1 to 10 of 10  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A024R1J9A0A024R1J9_HUMANNeurofibromin 2 (Bilateral acoustic neuroma), isoform CRA_eHomo sapiens (Human)9606590Representative & Seed
F6RPW5F6RPW5_MACMUFERM domain-containing proteinMacaca mulatta (Rhesus macaque)9544590
A0A2K5P4Z6A0A2K5P4Z6_CERATFERM domain-containing proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531590
A0A2K6NI50A0A2K6NI50_RHIROFERM domain-containing proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622590
A0A0D9RB86A0A0D9RB86_CHLSBFERM domain-containing proteinChlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711590
A0A2K5XBL4A0A2K5XBL4_MANLEFERM domain-containing proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568590
A0A2I2ZFQ4A0A2I2ZFQ4_GORGONeurofibromin 2Gorilla gorilla gorilla (Western lowland gorilla)9595590
A0A2K5WC53A0A2K5WC53_MACFAFERM domain-containing proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541590
P35240-3Isoform 3 of MERL_HUMAN3, IIHomo sapiens (Human)9606590
UPI0000141073merlin isoform X2Homo sapiens (Human)9606552

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A024R1J9

Checksumi: 99B732B48367D22A

FASTA59069,089
        10         20         30         40         50
MAGAIASRMS FSSLKRKQPK TFTVRIVTMD AEMEFNCEMK WKGKDLFDLV
60 70 80 90 100
CRTLGLRETW FFGLQYTIKD TVAWLKMDKK VLDHDVSKEE PVTFHFLAKF
110 120 130 140 150
YPENAEEELV QEITQHLFFL QVKKQILDEK IYCPPEASVL LASYAVQAKY
160 170 180 190 200
GDYDPSVHKR GFLAQEELLP KRVINLYQMT PEMWEERITA WYAEHRGRAR
210 220 230 240 250
DEAEMEYLKI AQDLEMYGVN YFAIRNKKGT ELLLGVDALG LHIYDPENRL
260 270 280 290 300
TPKISFPWNE IRNISYSDKE FTIKPLDKKI DVFKFNSSKL RVNKLILQLC
310 320 330 340 350
IGNHDLFMRR RKADSLEVQQ MKAQAREEKA RKQMERQRLA REKQMREEAE
360 370 380 390 400
RTRDELERRL LQMKEEATMA NEALMRSEET ADLLAEKAQI TEEEAKLLAQ
410 420 430 440 450
KAAEAEQEMQ RIKATAIRTE EEKRLMEQKV LEAEVLALKM AEESERRAKE
460 470 480 490 500
ADQLKQDLQE AREAERRAKQ KLLEIATKPT YPPMNPIPAP LPPDIPSFNL
510 520 530 540 550
IGDSLSFDFK DTDMKRLSME IEKEKVEYME KSKHLQEQLN ELKTEIEALK
560 570 580 590
LKERETALDI LHNENSDRGG SSKHNTIKKP QAQGRRPICI
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again