Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_A0A077B569 Group 13 allergen Sor h 13.02 n=1 Tax=Sorghum halepense TaxID=4560 RepID=A0A077B569_SORHL MACTGNAMRAFFLLAFVCAAHAGKDAPAKDGDAKAASGPGGSFDISKLGASGDGKKDSTK AVQEAWTSACGGTGKQTILIPKGDYLVGPLNFTGPCKGDVTIQVDGNLLATTDLSQYKGN WIEILRVDNLVITGKGKLDGQGPAVWSKNSCAKKYDCKILPNSLVLDYVNNGEVSGITLL NAKFFHMNVFQCKGVTIKDVTVTAPGDSPNTDGIHIGDSSKVTITGTTIGVGDDCISIGP GSTGINVTGVTCGPGHGISVGSLGRYKDEKDVTDINVKDCTLKKTSNGVRIKSYEDAACV ITASKLHYENIAMDDVANPIIIDMKYCPNKICTAKGDSKVTVKDVTFKNITGTSSTPEAV SLLCSDKIPCSGVTMDNIKVEYKGTNNKTMAVCQNAKGSATGCLKELACF

Members

Expand cluster to 90% or 50% identity.
1 to 1 of 1  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A077B569A0A077B569_SORHLGroup 13 allergen Sor h 13.02Sorghum halepense (Johnson grass) (Holcus halepensis)4560410Representative & Seed

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A077B569

Checksumi: EEA4CF36D0D443C7

FASTA41042,756
        10         20         30         40         50
MACTGNAMRA FFLLAFVCAA HAGKDAPAKD GDAKAASGPG GSFDISKLGA
60 70 80 90 100
SGDGKKDSTK AVQEAWTSAC GGTGKQTILI PKGDYLVGPL NFTGPCKGDV
110 120 130 140 150
TIQVDGNLLA TTDLSQYKGN WIEILRVDNL VITGKGKLDG QGPAVWSKNS
160 170 180 190 200
CAKKYDCKIL PNSLVLDYVN NGEVSGITLL NAKFFHMNVF QCKGVTIKDV
210 220 230 240 250
TVTAPGDSPN TDGIHIGDSS KVTITGTTIG VGDDCISIGP GSTGINVTGV
260 270 280 290 300
TCGPGHGISV GSLGRYKDEK DVTDINVKDC TLKKTSNGVR IKSYEDAACV
310 320 330 340 350
ITASKLHYEN IAMDDVANPI IIDMKYCPNK ICTAKGDSKV TVKDVTFKNI
360 370 380 390 400
TGTSSTPEAV SLLCSDKIPC SGVTMDNIKV EYKGTNNKTM AVCQNAKGSA
410
TGCLKELACF
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again