Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_A0A0C4FH71 Superoxide dismutase [Cu-Zn] n=1 Tax=Cyprinus carpio 'jian' TaxID=749192 RepID=A0A0C4FH71_CYPCA MAKKAVCVLKGTGEVTGTVYFEQESDGSPVKLSGEISGLTPGKHGFHVHAFGDNTNGCIS AGPHFNPHNKTHGGPTDSDRHVGDLGNVIAGDNGVAKIDIVDAMVTLSGEYSVIGRTMVI HEKEDDLGKGGNDESLKTGNAGGRLACGVIGITQ

Members

Expand cluster to 90% or 50% identity.
1 to 1 of 1  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A0C4FH71A0A0C4FH71_CYPCASuperoxide dismutase [Cu-Zn]Cyprinus carpio 'jian' (Jian carp)749192154Representative & Seed

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A0C4FH71

Checksumi: 78B2B1BD5CEF351F

FASTA15415,825
        10         20         30         40         50
MAKKAVCVLK GTGEVTGTVY FEQESDGSPV KLSGEISGLT PGKHGFHVHA
60 70 80 90 100
FGDNTNGCIS AGPHFNPHNK THGGPTDSDR HVGDLGNVIA GDNGVAKIDI
110 120 130 140 150
VDAMVTLSGE YSVIGRTMVI HEKEDDLGKG GNDESLKTGN AGGRLACGVI

GITQ
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again