Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_A0A0D9QUY3 NADH dehydrogenase [ubiquinone] 1 subunit C2 n=2 Tax=Chlorocebus TaxID=392815 RepID=A0A0D9QUY3_CHLSB MISRRNAEPLRFLPDESRSLPPPKLTDPRLLYLGFLGYCAGLTDNFIRRRPVLSAGLHRH LLYITAFYFVGYYLVKRGDYMCAVRDREMFGYMKLHPEDFPEKEKKTYAEIFEKFYPVR

Members

Expand cluster to 90% or 50% identity.
1 to 2 of 2  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A0D9QUY3A0A0D9QUY3_CHLSBNADH dehydrogenase [ubiquinone] 1 subunit C2Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711119Representative
I3XK04I3XK04_CHLAENADH dehydrogenase [ubiquinone] 1 subunit C2Chlorocebus aethiops (Green monkey) (Cercopithecus aethiops)9534119Seed

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A0D9QUY3

Checksumi: 2B7C56A36624688E

FASTA11914,192
        10         20         30         40         50
MISRRNAEPL RFLPDESRSL PPPKLTDPRL LYLGFLGYCA GLTDNFIRRR
60 70 80 90 100
PVLSAGLHRH LLYITAFYFV GYYLVKRGDY MCAVRDREMF GYMKLHPEDF
110
PEKEKKTYAE IFEKFYPVR
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again