Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_A0A0D9SG71 Ubiquitin-conjugating enzyme E2 A n=50 Tax=Euteleostomi TaxID=117571 RepID=A0A0D9SG71_HUMAN MVWNAVIFGPEGTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKMFHPNVYADGSICLDILQ NRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSWRDC

Members

Expand cluster to 90% or 50% identity.
1 to 25 of 50  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A0D9SG71A0A0D9SG71_HUMANUbiquitin-conjugating enzyme E2 AHomo sapiens (Human)9606119Representative
G1N8H4G1N8H4_MELGAUbiquitin conjugating enzyme E2 AMeleagris gallopavo (Wild turkey)9103102
A0A556V0D3A0A556V0D3_BAGYAADP/ATP translocase 2Bagarius yarrelli (Goonch) (Bagrus yarrelli)1757741,225Seed
A0A2K6LGV2A0A2K6LGV2_RHIBEUBIQUITIN_CONJUGAT_2 domain-containing proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621101
A0A2Z4EGF4A0A2Z4EGF4_ACIGUUbiquitin-conjugating enzyme E2 A (Fragment)Acipenser gueldenstaedtii (Russian sturgeon) (Danube sturgeon)790234
A0A0J9YUW6A0A0J9YUW6_MOUSEUbiquitin-conjugating enzyme E2 A (Fragment)Mus musculus (Mouse)10090110
K9KCC9K9KCC9_HORSEUbiquitin-conjugating enzyme E2 A-like protein (Fragment)Equus caballus (Horse)979698
A0A1A6GT12A0A1A6GT12_NEOLEUBIQUITIN_CONJUGAT_2 domain-containing protein (Fragment)Neotoma lepida (Desert woodrat)5621668
A0A2Z4EJJ4A0A2Z4EJJ4_ACIBEUbiquitin-conjugating enzyme E2 A (Fragment)Acipenser baerii (Siberian sturgeon)27689128
A0A091J2C5A0A091J2C5_EGRGAUbiquitin-conjugating enzyme E2 A (Fragment)Egretta garzetta (Little egret)188379102
A0A093JLS0A0A093JLS0_STRCAUbiquitin-conjugating enzyme E2 A (Fragment)Struthio camelus australis441894102
A0A093NNJ6A0A093NNJ6_PYGADUbiquitin-conjugating enzyme E2 A (Fragment)Pygoscelis adeliae (Adelie penguin)9238102
A0A087VE90A0A087VE90_BALREUbiquitin-conjugating enzyme E2 A (Fragment)Balearica regulorum gibbericeps (East African grey crowned-crane)100784102
R0JT79R0JT79_ANAPLUbiquitin-conjugating enzyme E2 A (Fragment)Anas platyrhynchos (Mallard) (Anas boschas)8839102
A0A091W7I5A0A091W7I5_OPIHOUbiquitin-conjugating enzyme E2 A (Fragment)Opisthocomus hoazin (Hoatzin) (Phasianus hoazin)30419102
A0A093R030A0A093R030_PHACAUbiquitin-conjugating enzyme E2 A (Fragment)Phalacrocorax carbo (Great cormorant) (Pelecanus carbo)9209102
A0A091H1I3A0A091H1I3_9AVESUbiquitin-conjugating enzyme E2 A (Fragment)Cuculus canorus (common cuckoo)55661102
A0A091HZW7A0A091HZW7_CALANUbiquitin-conjugating enzyme E2 A (Fragment)Calypte anna (Anna's hummingbird) (Archilochus anna)9244102
A0A091VJI9A0A091VJI9_PHORBUbiquitin-conjugating enzyme E2 A (Fragment)Phoenicopterus ruber ruber9218102
A0A093CVF2A0A093CVF2_TAUERUbiquitin-conjugating enzyme E2 A (Fragment)Tauraco erythrolophus (Red-crested turaco)121530102
A0A094L9Y1A0A094L9Y1_ANTCRUbiquitin-conjugating enzyme E2 A (Fragment)Antrostomus carolinensis (Chuck-will's-widow) (Caprimulgus carolinensis)279965102
A0A093F9K2A0A093F9K2_TYTALUbiquitin-conjugating enzyme E2 A (Fragment)Tyto alba (Barn owl)56313102
Q8VH44Q8VH44_MOUSEUbiquitin-conjugating enzyme (Fragment)Mus musculus (Mouse)1009081
Q8WXB3Q8WXB3_HUMANUbiquitin-conjugating enzyme (Fragment)Homo sapiens (Human)960680
H9EP32H9EP32_MACMUUbiquitin-conjugating enzyme E2 A isoform 1Macaca mulatta (Rhesus macaque)954477

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A0D9SG71

Checksumi: 7F234837A784BBB3

FASTA11913,635
        10         20         30         40         50
MVWNAVIFGP EGTPFEDGTF KLTIEFTEEY PNKPPTVRFV SKMFHPNVYA
60 70 80 90 100
DGSICLDILQ NRWSPTYDVS SILTSIQSLL DEPNPNSPAN SQAAQLYQEN
110
KREYEKRVSA IVEQSWRDC
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again