Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_A0A0K0WX26 Cytochrome c oxidase subunit 1 n=15 Tax=Spirometra TaxID=46580 RepID=A0A0K0WX26_SPIER MAKFSFFSWLFTLDHKRVGMIYTLIGIWSGFVGLSFSVMIRVNFVEPYFNVISSDCYNFL ITNHGIIMIFFFLMPGLMGGLGNYLIPLLPGLPNLNLPRLNPLNAGWLFPSILFLGLSMG WGAGNGGTFYPPPPPSLFSDSRGVNLLSFSLLLAGLSSLLGSINFIWTLYSAFVDNFVSR SSILLGSYLFTSILLLLTIPVLAAAITMLLFDRNFGSAFFDPLGGGDPVLFQHMFWFFGH PEVYVLILPGFGMVSHVCSNLGCSYDTFGFYGLLFAMFSIVCLGSVVWGHHMFTVGLDVK TAVFFSSVTMIIGVPTGIKVFSWLYMILNSRVSLREPVFWWVLSFIVLFTMGGVTGIILS ACVLDNILHDTWFVVAHFHYVMSLGSYISVIIFFVWWWPVITGVSLNKYLLQCHCIVSNV GFNLCFFPMHYFGICGLPRRVCVYESGYAWVNMLCSIGSFVSAFSGCFFIFILWESLANK NVVIGYYGSSSTLLNLCWSPVPYHSNFFVRGLFVDYSVLAF

Members

Expand cluster to 90% or 50% identity.
1 to 15 of 15  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A0K0WX26A0A0K0WX26_SPIERCytochrome c oxidase subunit 1Spirometra erinaceieuropaei (Tapeworm) (Spirometra erinacei)99802521Representative & Seed
E5DVT4E5DVT4_SPIERCytochrome c oxidase subunit 1 (Fragment)Spirometra erinaceieuropaei (Tapeworm) (Spirometra erinacei)99802132
R4QRL7R4QRL7_9CESTCytochrome c oxidase subunit 1 (Fragment)Spirometra sp. QN-2013A1333672132
R4QQQ0R4QQQ0_9CESTCytochrome c oxidase subunit 1 (Fragment)Spirometra sp. QN-2013B1333673132
Q711S6Q711S6_SPIERCytochrome c oxidase subunit 1 (Fragment)Spirometra erinaceieuropaei (Tapeworm) (Spirometra erinacei)99802131
W5R5F1W5R5F1_SPIERCytochrome c oxidase subunit 1 (Fragment)Spirometra erinaceieuropaei (Tapeworm) (Spirometra erinacei)99802129
A0A1B4Z421A0A1B4Z421_SPIERCytochrome c oxidase subunit 1 (Fragment)Spirometra erinaceieuropaei (Tapeworm) (Spirometra erinacei)99802139
F8WQX9F8WQX9_SPIERCytochrome c oxidase subunit 1 (Fragment)Spirometra erinaceieuropaei (Tapeworm) (Spirometra erinacei)9980251
A0A5A4DKS5A0A5A4DKS5_SPIERCytochrome c oxidase subunit 1 (Fragment)Spirometra erinaceieuropaei (Tapeworm) (Spirometra erinacei)9980284
D6BPM5D6BPM5_SPIERCytochrome c oxidase subunit 1 (Fragment)Spirometra erinaceieuropaei (Tapeworm) (Spirometra erinacei)99802111
A0A067YEW3A0A067YEW3_SPIERCytochrome c oxidase subunit 1 (Fragment)Spirometra erinaceieuropaei (Tapeworm) (Spirometra erinacei)99802142
A0A223M0I9A0A223M0I9_SPIERCytochrome c oxidase subunit 1 (Fragment)Spirometra erinaceieuropaei (Tapeworm) (Spirometra erinacei)99802185
F8WQX8F8WQX8_SPIERCytochrome c oxidase subunit 1 (Fragment)Spirometra erinaceieuropaei (Tapeworm) (Spirometra erinacei)9980250
A4PET5A4PET5_SPIERCytochrome c oxidase subunit 1 (Fragment)Spirometra erinaceieuropaei (Tapeworm) (Spirometra erinacei)99802130
A0A1L7NS67A0A1L7NS67_SPIERCytochrome c oxidase subunit 1 (Fragment)Spirometra erinaceieuropaei (Tapeworm) (Spirometra erinacei)9980243

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A0K0WX26

Checksumi: 2B2E52691A69DD73

FASTA52158,257
        10         20         30         40         50
MAKFSFFSWL FTLDHKRVGM IYTLIGIWSG FVGLSFSVMI RVNFVEPYFN
60 70 80 90 100
VISSDCYNFL ITNHGIIMIF FFLMPGLMGG LGNYLIPLLP GLPNLNLPRL
110 120 130 140 150
NPLNAGWLFP SILFLGLSMG WGAGNGGTFY PPPPPSLFSD SRGVNLLSFS
160 170 180 190 200
LLLAGLSSLL GSINFIWTLY SAFVDNFVSR SSILLGSYLF TSILLLLTIP
210 220 230 240 250
VLAAAITMLL FDRNFGSAFF DPLGGGDPVL FQHMFWFFGH PEVYVLILPG
260 270 280 290 300
FGMVSHVCSN LGCSYDTFGF YGLLFAMFSI VCLGSVVWGH HMFTVGLDVK
310 320 330 340 350
TAVFFSSVTM IIGVPTGIKV FSWLYMILNS RVSLREPVFW WVLSFIVLFT
360 370 380 390 400
MGGVTGIILS ACVLDNILHD TWFVVAHFHY VMSLGSYISV IIFFVWWWPV
410 420 430 440 450
ITGVSLNKYL LQCHCIVSNV GFNLCFFPMH YFGICGLPRR VCVYESGYAW
460 470 480 490 500
VNMLCSIGSF VSAFSGCFFI FILWESLANK NVVIGYYGSS STLLNLCWSP
510 520
VPYHSNFFVR GLFVDYSVLA F
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again