Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_A0A1A7WSK2 IWS1 homolog n=2 Tax=Iconisemion striatum TaxID=60296 RepID=A0A1A7WSK2_9TELE MDGEEDDFMSGSHSDDGGATPVQDENPPSDGEDMRSDHQSEDEGSNDAMETGGAASGSDT EDRHGANSDSDGEAPGSHRDRSDSEAEGPPLADSDEDSPVKRRMSASDNEEGEESPEKRQ MRGSDNEESSPIKHDASDEDEEGSSPIKHDASDNEEEEQSSPIKHDASDNEEGSSPIKRR GSSSEVEGGEGVPKAAANSDSDEEEAKPAASPNRQSDSDSENEMPARRKTAQIDSEEEEE KQEEVGGGGKWKGKMQSDSEEEEEEEQRQRRKAAVGSDEEEHREEEEKQQRDDSDEDDET PVKRKKAVLSDSEEEEEDKAGKPAVKRSRAMSDNENSDSDDGSVGPDKSLAAKLKELGSD SGSDDEDRTKAATGKKDEKALFGSDSESGDEEEKMIADIFGESGDEEGEEFTGFNQEDLE ADNKESKEKQQAEEESDSDEGVDRGGQDMSFMSDFDIMLAKRKAMNSKKRRHRDGGTFIS DADDVVSAMITKMNEAAEEDRSLNSQKKPALKKLTLLPQVVMHLKKQDLKETFIDSGVMS AIKEWISPLPDKSLPALRIREELLRILQELPGVSQETLKHSGIGRAVMFLYKHPKESRPN KDIALKLINEWSRPIFGLTSNYKGMTREERQQRDLDQQTPQRRRLR

Members

Expand cluster to 90% or 50% identity.
1 to 2 of 2  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A1A7WSK2A0A1A7WSK2_9TELEIWS1 homologIconisemion striatum60296646Representative & Seed
A0A1A7YKI6A0A1A7YKI6_9TELEIWS1 homolog (Fragment)Iconisemion striatum60296152

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A1A7WSK2

Checksumi: BC203350C9B626C5

FASTA64671,454
        10         20         30         40         50
MDGEEDDFMS GSHSDDGGAT PVQDENPPSD GEDMRSDHQS EDEGSNDAME
60 70 80 90 100
TGGAASGSDT EDRHGANSDS DGEAPGSHRD RSDSEAEGPP LADSDEDSPV
110 120 130 140 150
KRRMSASDNE EGEESPEKRQ MRGSDNEESS PIKHDASDED EEGSSPIKHD
160 170 180 190 200
ASDNEEEEQS SPIKHDASDN EEGSSPIKRR GSSSEVEGGE GVPKAAANSD
210 220 230 240 250
SDEEEAKPAA SPNRQSDSDS ENEMPARRKT AQIDSEEEEE KQEEVGGGGK
260 270 280 290 300
WKGKMQSDSE EEEEEEQRQR RKAAVGSDEE EHREEEEKQQ RDDSDEDDET
310 320 330 340 350
PVKRKKAVLS DSEEEEEDKA GKPAVKRSRA MSDNENSDSD DGSVGPDKSL
360 370 380 390 400
AAKLKELGSD SGSDDEDRTK AATGKKDEKA LFGSDSESGD EEEKMIADIF
410 420 430 440 450
GESGDEEGEE FTGFNQEDLE ADNKESKEKQ QAEEESDSDE GVDRGGQDMS
460 470 480 490 500
FMSDFDIMLA KRKAMNSKKR RHRDGGTFIS DADDVVSAMI TKMNEAAEED
510 520 530 540 550
RSLNSQKKPA LKKLTLLPQV VMHLKKQDLK ETFIDSGVMS AIKEWISPLP
560 570 580 590 600
DKSLPALRIR EELLRILQEL PGVSQETLKH SGIGRAVMFL YKHPKESRPN
610 620 630 640
KDIALKLINE WSRPIFGLTS NYKGMTREER QQRDLDQQTP QRRRLR
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again