Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_A0A1B0GTX0 Sodium channel protein type 2 subunit alpha n=2 Tax=Hominidae TaxID=9604 RepID=A0A1B0GTX0_HUMAN MAQSVLVPPGPDSFRFFTRESLAAIEQRIAEEKAKRPKQERKDEDDENGPKPNSDLEAGK SLPFIYGDIPPEMVSVPLEDLDPYYINKKVSS

Members

Expand cluster to 90% or 50% identity.
1 to 2 of 2  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A1B0GTX0A0A1B0GTX0_HUMANSodium channel protein type 2 subunit alphaHomo sapiens (Human)960692Representative & Seed
A0A2J8T4Y5A0A2J8T4Y5_PONABSCN2A isoform 13Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)960192

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A1B0GTX0

Checksumi: B50FE59E4A8B7989

FASTA9210,365
        10         20         30         40         50
MAQSVLVPPG PDSFRFFTRE SLAAIEQRIA EEKAKRPKQE RKDEDDENGP
60 70 80 90
KPNSDLEAGK SLPFIYGDIP PEMVSVPLED LDPYYINKKV SS
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again