Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_A0A1D5QD61 Ribosomal_L28e domain-containing protein n=14 Tax=Catarrhini TaxID=9526 RepID=A0A1D5QD61_MACMU MSAHLQWMVVRNCSSFLIKRNKQTYSTEPNNLKARNSFRYNGLIHRKTVGVEPAADGKGV VVVIKRRSE

Members

Expand cluster to 90% or 50% identity.
1 to 14 of 14  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A1D5QD61A0A1D5QD61_MACMURibosomal_L28e domain-containing proteinMacaca mulatta (Rhesus macaque)954469Representative
A0A2K6NXH5A0A2K6NXH5_RHIRORibosomal_L28e domain-containing proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)6162269Seed
A0A2J8R3F9A0A2J8R3F9_PONABRPL28 isoform 2Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)960169
A0A2J8IWU0A0A2J8IWU0_PANTRRPL28 isoform 9Pan troglodytes (Chimpanzee)959869
A0A2K5LPJ1A0A2K5LPJ1_CERATRibosomal_L28e domain-containing proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)953169
A0A2I3NGR7A0A2I3NGR7_PAPANRibosomal_L28e domain-containing proteinPapio anubis (Olive baboon)955569
A0A2R9BKX1A0A2R9BKX1_PANPARibosomal_L28e domain-containing proteinPan paniscus (Pygmy chimpanzee) (Bonobo)959769
A0A2K5ZSX5A0A2K5ZSX5_MANLERibosomal_L28e domain-containing proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)956869
A0A2I3H156A0A2I3H156_NOMLERibosomal_L28e domain-containing proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)6185369
A0A2I2ZF02A0A2I2ZF02_GORGORibosomal protein L28Gorilla gorilla gorilla (Western lowland gorilla)959569
A0A2K5VDV5A0A2K5VDV5_MACFARibosomal_L28e domain-containing proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)954169
A0A2K6LCT8A0A2K6LCT8_RHIBERibosomal_L28e domain-containing proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)6162169
A0A2K6C1K6A0A2K6C1K6_MACNERibosomal_L28e domain-containing proteinMacaca nemestrina (Pig-tailed macaque)954569
P46779-4Isoform 4 of RL28_HUMAN4Homo sapiens (Human)960669

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A1D5QD61

Checksumi: EDE20EE54DFE31FE

FASTA697,888
        10         20         30         40         50
MSAHLQWMVV RNCSSFLIKR NKQTYSTEPN NLKARNSFRY NGLIHRKTVG
60
VEPAADGKGV VVVIKRRSE
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again