Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_A0A1S3FZY2 F-box only protein 17 n=1 Tax=Dipodomys ordii TaxID=10020 RepID=A0A1S3FZY2_DIPOR MGAGPSLRRQQRPSMEPPVALDSLPPELLVQVLSHVPPRALVTRCRLVCRAWRDVVDGPS VWLLQLARDRSAEGRAFYALAQRCPSQGEDQEEFPLCALARFCLRAPLGRNLIFNSCGEE GFRGWEVEHGGNGWAVEKNLTLVPGAPSQTCFVTSFEWCFKRQLVDLVMEGVWQELLDSA QIEICVADWWGARENCGCIYRLRVRLLDMYENEVVKFSASPNPVLQWTERSCRQVSHVFT NFGKGIRYVSFEQYGRDTRSWVGHYGTLVTHSSVRVRIRLS

Members

Expand cluster to 90% or 50% identity.
1 to 1 of 1  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A1S3FZY2A0A1S3FZY2_DIPORF-box only protein 17Dipodomys ordii (Ord's kangaroo rat)10020281Representative & Seed

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A1S3FZY2

Checksumi: 872B3EF2E6B87C86

FASTA28131,975
        10         20         30         40         50
MGAGPSLRRQ QRPSMEPPVA LDSLPPELLV QVLSHVPPRA LVTRCRLVCR
60 70 80 90 100
AWRDVVDGPS VWLLQLARDR SAEGRAFYAL AQRCPSQGED QEEFPLCALA
110 120 130 140 150
RFCLRAPLGR NLIFNSCGEE GFRGWEVEHG GNGWAVEKNL TLVPGAPSQT
160 170 180 190 200
CFVTSFEWCF KRQLVDLVME GVWQELLDSA QIEICVADWW GARENCGCIY
210 220 230 240 250
RLRVRLLDMY ENEVVKFSAS PNPVLQWTER SCRQVSHVFT NFGKGIRYVS
260 270 280
FEQYGRDTRS WVGHYGTLVT HSSVRVRIRL S
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again