Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_A0A1U7Q9L6 GA-binding protein alpha chain n=1 Tax=Mesocricetus auratus TaxID=10036 RepID=A0A1U7Q9L6_MESAU MTKREAEELIEIEIDGTEKPECTEESIVEQTYAPAECVSQAIDINEPIGNLKKLLEPRLQ CSLDAHEICLQDIQLDPERSLFDQGVKTDGTVQLSVQVISYQGIEPKLNILEIVKTAETV EVVIDPDAHHAEAEAHLVEEAQVITLDGTKHITTISDETSEQVTRWAAALEGYRKEQERL GIPYDPIQWSTDQVLHWVVWVMKEFSMTDIDLTTLNISGRELCSLNQEDFFQRVPRGEIL WSHLELLRKYVLASQEQQMNEIVTIDQPVQIIPASVQSATPTTIKVINSSAKTAKVPRSP RISGEDRSSPGNRTGNNGQIQLWQFLLELLTDKDARDCISWVGDEGEFKLNQPELVAQKW GQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDLKTLIGYSAAELNRLVTE CEQKKLAKMQLHGIAQPVTAVALAAASLQTEKDN

Members

Expand cluster to 90% or 50% identity.
1 to 1 of 1  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A1U7Q9L6A0A1U7Q9L6_MESAUGA-binding protein alpha chainMesocricetus auratus (Golden hamster)10036454Representative & Seed

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A1U7Q9L6

Checksumi: F05E3FEBD0564C28

FASTA45451,308
        10         20         30         40         50
MTKREAEELI EIEIDGTEKP ECTEESIVEQ TYAPAECVSQ AIDINEPIGN
60 70 80 90 100
LKKLLEPRLQ CSLDAHEICL QDIQLDPERS LFDQGVKTDG TVQLSVQVIS
110 120 130 140 150
YQGIEPKLNI LEIVKTAETV EVVIDPDAHH AEAEAHLVEE AQVITLDGTK
160 170 180 190 200
HITTISDETS EQVTRWAAAL EGYRKEQERL GIPYDPIQWS TDQVLHWVVW
210 220 230 240 250
VMKEFSMTDI DLTTLNISGR ELCSLNQEDF FQRVPRGEIL WSHLELLRKY
260 270 280 290 300
VLASQEQQMN EIVTIDQPVQ IIPASVQSAT PTTIKVINSS AKTAKVPRSP
310 320 330 340 350
RISGEDRSSP GNRTGNNGQI QLWQFLLELL TDKDARDCIS WVGDEGEFKL
360 370 380 390 400
NQPELVAQKW GQRKNKPTMN YEKLSRALRY YYDGDMICKV QGKRFVYKFV
410 420 430 440 450
CDLKTLIGYS AAELNRLVTE CEQKKLAKMQ LHGIAQPVTA VALAAASLQT

EKDN
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again