Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_A0A212DGJ5 TSSC4 n=1 Tax=Cervus elaphus hippelaphus TaxID=46360 RepID=A0A212DGJ5_CEREH MAEAGDSQHFFDSEVDVLPPDTVSLSDSDSDLSLPDGAGVDALSPGGLPGQASGDSGPDE PPSPPRGLPTEAVQPFHLRGTSSTFSQRSHSIFDGLEGAARRAVPAVAPASPGDRGSFRQ LLTPSSQPAAGGPSRAAGSPAPPRAPPVPDYVTHPERWTRYSLEEVAEASEQSNRAAALA FLGPQNLAAPGDYVPSFNQDPSSCGEGRLVFTKPARASEARPDRRRVPRKAGEPGRSDPG VPGAAGGEGPVELAHLARPGSPEAEEWSGPRGGLQEVGTPAGVAHTRSGSSTPLVETVGF HGSRKRSRDHFRGRGPLPEHGHSPEAPGAEV

Members

Expand cluster to 90% or 50% identity.
1 to 1 of 1  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A212DGJ5A0A212DGJ5_CEREHTSSC4Cervus elaphus hippelaphus (European red deer)46360331Representative & Seed

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A212DGJ5

Checksumi: A787B9E9EE917D75

FASTA33134,118
        10         20         30         40         50
MAEAGDSQHF FDSEVDVLPP DTVSLSDSDS DLSLPDGAGV DALSPGGLPG
60 70 80 90 100
QASGDSGPDE PPSPPRGLPT EAVQPFHLRG TSSTFSQRSH SIFDGLEGAA
110 120 130 140 150
RRAVPAVAPA SPGDRGSFRQ LLTPSSQPAA GGPSRAAGSP APPRAPPVPD
160 170 180 190 200
YVTHPERWTR YSLEEVAEAS EQSNRAAALA FLGPQNLAAP GDYVPSFNQD
210 220 230 240 250
PSSCGEGRLV FTKPARASEA RPDRRRVPRK AGEPGRSDPG VPGAAGGEGP
260 270 280 290 300
VELAHLARPG SPEAEEWSGP RGGLQEVGTP AGVAHTRSGS STPLVETVGF
310 320 330
HGSRKRSRDH FRGRGPLPEH GHSPEAPGAE V
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again