Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_A0A235I8I5 50S ribosomal protein L21 n=2 Tax=Nostoc TaxID=1177 RepID=A0A235I8I5_9NOSO MTYAIIETGGKQIRVEPGRFYDIELLPIEPDEKVTIDYVLLVQHDGEVSIGQPLVTGATV EGTVMRHYRGRKVLVYKMKPKKKTRKKRGHRQEVTRLMIDSITLNGEVFVAQGEAEKESP VLDETPAEEVEVAAE

Members

Expand cluster to 90% or 50% identity.
1 to 2 of 2  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A235I8I5A0A235I8I5_9NOSO50S ribosomal protein L21Nostoc sp. 'Peltigera membranacea cyanobiont' 2132014530135Representative & Seed
A0A2L2NE82A0A2L2NE82_9NOSO50S ribosomal protein L21Nostoc sp. 'Peltigera membranacea cyanobiont' N61261031135

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A235I8I5

Checksumi: 34AACF533FCBA7E8

FASTA13515,221
        10         20         30         40         50
MTYAIIETGG KQIRVEPGRF YDIELLPIEP DEKVTIDYVL LVQHDGEVSI
60 70 80 90 100
GQPLVTGATV EGTVMRHYRG RKVLVYKMKP KKKTRKKRGH RQEVTRLMID
110 120 130
SITLNGEVFV AQGEAEKESP VLDETPAEEV EVAAE
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again