Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_A0A2I2ZS35 Bromodomain and PHD finger containing 1 n=2 Tax=Homininae TaxID=207598 RepID=A0A2I2ZS35_GORGO MGVDFDVKTFCHNLRATKPPYECPVETCRKVYKSYSGIEYHLYHYDHDNPPPPQQTPLRK HKKKGRQSRPANKQSPSPSEVSQSPGREVMSYAQAQRMVEVDLHGRVHRISIFDNLDVVS EDEEAPEEAPENGSNKENTETPAATPKSGKHKNKEKRKDSNHHHHHNVSASTTPKLPEVV YRELEQDTPDAPPRPTSYYRYIEKSAEELDEEVEYDMDEEDYIWLDIMNERRKTEGVSPI PQEIFEYLMDRLEKESYFESHNKGDPNALVDEDAVCCICNDGECQNSNVILFCDMCNLAV HQECYGVPYIPEGQWLCRRCLQSPSRAVDCALCPNKGGAFKQTDDGRWAHVVCALWIPEV CFANTVFLEPIDSIEHIPPARWKLTCYICKQRGSGACIQCHKANCYTAFHVTCAQQAGLY MKMEPVRETGANGTSFSVRKTAYCDIHTPPGSARRLPALSHSEGEEDEDEEEDEGKGWSS EKVKKAKAKSRIKMKKARKILAEKRAAAPVVSVPCIPPHRLSKITNRLTIQRKSQFMQRL HSYWTLKRQSRNGVPLLRRLQTHLQSQRNCDQVGRDSEDKNWALKEQLKSWQRLRHDLER ARLLVELIRKREKLKRETIKVQQIAMEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLS EVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVR LREQGGAVLRQARRQAEKMGIDFETGMHIPHSLAGDEATHHTEDAAEEERLVLLENQKHL PVEEQLKLLLERLDEVNASKQSVGRSRRAKMIKKEMTALRRKLAHQRETGRDGPERHGPS SRGSLTPHPAACDKDGQTDSAAEESSSQETSKDLPANGFSGGNQPVKKSFLVYRNDCSLP RSSSDSESSSSSSSSAASDRTSTTPSKQGRGKPSFSRGTFPEDSSEDTSGTENEAYSVGT GRGVGHSMVRKSLGRGAGWLSEDEDSPLDALDLVWAKCRGYPSYPALIIDPKMPREGMFH HGVPIPVPPLEVLKLGEQMTQEAREHLYLVLFFDNKRTWQWLPRTKLVPLGVNQDLDKEK MLEGRKSNIRKSVQIAYHRALQHRSKVQGEQSSETSDSD

Members

Expand cluster to 90% or 50% identity.
1 to 2 of 2  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A2I2ZS35A0A2I2ZS35_GORGOBromodomain and PHD finger containing 1Gorilla gorilla gorilla (Western lowland gorilla)95951,119Representative & Seed
P55201-4Isoform 4 of BRPF1_HUMAN4Homo sapiens (Human)96061,119

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A2I2ZS35

Checksumi: 1DD0F0BFDF1AFDCC

FASTA1,119127,363
        10         20         30         40         50
MGVDFDVKTF CHNLRATKPP YECPVETCRK VYKSYSGIEY HLYHYDHDNP
60 70 80 90 100
PPPQQTPLRK HKKKGRQSRP ANKQSPSPSE VSQSPGREVM SYAQAQRMVE
110 120 130 140 150
VDLHGRVHRI SIFDNLDVVS EDEEAPEEAP ENGSNKENTE TPAATPKSGK
160 170 180 190 200
HKNKEKRKDS NHHHHHNVSA STTPKLPEVV YRELEQDTPD APPRPTSYYR
210 220 230 240 250
YIEKSAEELD EEVEYDMDEE DYIWLDIMNE RRKTEGVSPI PQEIFEYLMD
260 270 280 290 300
RLEKESYFES HNKGDPNALV DEDAVCCICN DGECQNSNVI LFCDMCNLAV
310 320 330 340 350
HQECYGVPYI PEGQWLCRRC LQSPSRAVDC ALCPNKGGAF KQTDDGRWAH
360 370 380 390 400
VVCALWIPEV CFANTVFLEP IDSIEHIPPA RWKLTCYICK QRGSGACIQC
410 420 430 440 450
HKANCYTAFH VTCAQQAGLY MKMEPVRETG ANGTSFSVRK TAYCDIHTPP
460 470 480 490 500
GSARRLPALS HSEGEEDEDE EEDEGKGWSS EKVKKAKAKS RIKMKKARKI
510 520 530 540 550
LAEKRAAAPV VSVPCIPPHR LSKITNRLTI QRKSQFMQRL HSYWTLKRQS
560 570 580 590 600
RNGVPLLRRL QTHLQSQRNC DQVGRDSEDK NWALKEQLKS WQRLRHDLER
610 620 630 640 650
ARLLVELIRK REKLKRETIK VQQIAMEMQL TPFLILLRKT LEQLQEKDTG
660 670 680 690 700
NIFSEPVPLS EVPDYLDHIK KPMDFFTMKQ NLEAYRYLNF DDFEEDFNLI
710 720 730 740 750
VSNCLKYNAK DTIFYRAAVR LREQGGAVLR QARRQAEKMG IDFETGMHIP
760 770 780 790 800
HSLAGDEATH HTEDAAEEER LVLLENQKHL PVEEQLKLLL ERLDEVNASK
810 820 830 840 850
QSVGRSRRAK MIKKEMTALR RKLAHQRETG RDGPERHGPS SRGSLTPHPA
860 870 880 890 900
ACDKDGQTDS AAEESSSQET SKDLPANGFS GGNQPVKKSF LVYRNDCSLP
910 920 930 940 950
RSSSDSESSS SSSSSAASDR TSTTPSKQGR GKPSFSRGTF PEDSSEDTSG
960 970 980 990 1000
TENEAYSVGT GRGVGHSMVR KSLGRGAGWL SEDEDSPLDA LDLVWAKCRG
1010 1020 1030 1040 1050
YPSYPALIID PKMPREGMFH HGVPIPVPPL EVLKLGEQMT QEAREHLYLV
1060 1070 1080 1090 1100
LFFDNKRTWQ WLPRTKLVPL GVNQDLDKEK MLEGRKSNIR KSVQIAYHRA
1110
LQHRSKVQGE QSSETSDSD
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again