Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_A0A2I3FW85 Fe2OG dioxygenase domain-containing protein n=2 Tax=Nomascus leucogenys TaxID=61853 RepID=A0A2I3FW85_NOMLE MDEKRRRARVQGAWAAPVKSQAIAQPATTAKSHLHQKPGQTWKNKEHHLSDREFVFKEPQ QVVRRAPEPRVIDREGVYEISLLPTGVSRVCLYPGFVDVKEADWILEQLCQDVPWKQRTG IREDITYQQPRLTAWYGELPYTYSRITMEANPHWHPVLRTLKNRIEENTGHTFNSLLCNL YRNEKDSVDWHSDDEPSLGRCPIIASLSFGATRTFEMRKKPPPEENGDYTYVERVKIPLD HGTLLIMEGATQADWQHRVPKEYHSRELRVNLTFRTVYPDPQGAPW

Members

Expand cluster to 90% or 50% identity.
1 to 2 of 2  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A2I3FW85A0A2I3FW85_NOMLEFe2OG dioxygenase domain-containing proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853286Representative
UPI00020AA406alpha-ketoglutarate-dependent dioxygenase alkB homolog 3Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853302Seed

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A2I3FW85

Checksumi: FB86DEE6F41E8F65

FASTA28633,349
        10         20         30         40         50
MDEKRRRARV QGAWAAPVKS QAIAQPATTA KSHLHQKPGQ TWKNKEHHLS
60 70 80 90 100
DREFVFKEPQ QVVRRAPEPR VIDREGVYEI SLLPTGVSRV CLYPGFVDVK
110 120 130 140 150
EADWILEQLC QDVPWKQRTG IREDITYQQP RLTAWYGELP YTYSRITMEA
160 170 180 190 200
NPHWHPVLRT LKNRIEENTG HTFNSLLCNL YRNEKDSVDW HSDDEPSLGR
210 220 230 240 250
CPIIASLSFG ATRTFEMRKK PPPEENGDYT YVERVKIPLD HGTLLIMEGA
260 270 280
TQADWQHRVP KEYHSRELRV NLTFRTVYPD PQGAPW
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again