Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_A0A2I3REP2 Bardet-Biedl syndrome 5 protein homolog n=4 Tax=Homininae TaxID=207598 RepID=A0A2I3REP2_PANTR MSVLDALWEDRDVRFDLSAQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRILWH SLALSRVNVSVGYNCILNITTRTANSKLRGQTEALYILTKCNSTRFEFIFTNLVPGSPRL FTSVMAVHRAYETSKMYRDFKLRSALIQNKQLRLLPQEHVYDKINGVWNLSSDQGNLGTF FITNVRIVWHANMNDSFNVSIPYLQISGGYVLGFKIDPVEKLQESVKEINSLHKVYSASP IFGVDYEMEEKPQPLEALTVEQIQDDVEIDSDGHTDAFVAYFADGNKQQDREPVFSEELG LAIEKLKDGFTLQGLWEVMS

Members

Expand cluster to 90% or 50% identity.
1 to 4 of 4  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A2I3REP2A0A2I3REP2_PANTRBardet-Biedl syndrome 5 protein homologPan troglodytes (Chimpanzee)9598320Representative
A0A0S2Z6S7A0A0S2Z6S7_HUMANBardet-Biedl syndrome 5 isoform 2 (Fragment)Homo sapiens (Human)9606320Seed
A0A2R9BW62A0A2R9BW62_PANPABardet-Biedl syndrome 5 protein homologPan paniscus (Pygmy chimpanzee) (Bonobo)9597320
Q8N3I7-2Isoform 2 of BBS5_HUMAN2Homo sapiens (Human)9606320

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A2I3REP2

Checksumi: 843BC731AE686410

FASTA32036,397
        10         20         30         40         50
MSVLDALWED RDVRFDLSAQ QMKTRPGEVL IDCLDSIEDT KGNNGDRGRL
60 70 80 90 100
LVTNLRILWH SLALSRVNVS VGYNCILNIT TRTANSKLRG QTEALYILTK
110 120 130 140 150
CNSTRFEFIF TNLVPGSPRL FTSVMAVHRA YETSKMYRDF KLRSALIQNK
160 170 180 190 200
QLRLLPQEHV YDKINGVWNL SSDQGNLGTF FITNVRIVWH ANMNDSFNVS
210 220 230 240 250
IPYLQISGGY VLGFKIDPVE KLQESVKEIN SLHKVYSASP IFGVDYEMEE
260 270 280 290 300
KPQPLEALTV EQIQDDVEID SDGHTDAFVA YFADGNKQQD REPVFSEELG
310 320
LAIEKLKDGF TLQGLWEVMS
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again