Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_A0A2I3RGR9 PRKAR1A isoform 18 n=3 Tax=Homininae TaxID=207598 RepID=A0A2I3RGR9_PANTR MESGSTAASEEARSLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFERLEKE EAKQIQNLQKAGTRTDSREDEISPPPPNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPK DYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFSVSFIAGETVIQQGDEGDNFYVIDQG ETDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTL RKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSA AVLQRRSENEEFVEVGRLGPSDYFGHLIISRRSIPLG

Members

Expand cluster to 90% or 50% identity.
1 to 3 of 3  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A2I3RGR9A0A2I3RGR9_PANTRPRKAR1A isoform 18Pan troglodytes (Chimpanzee)9598337Representative & Seed
A0A2R9AX54A0A2R9AX54_PANPAUncharacterized proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597337
P10644-2Isoform 2 of KAP0_HUMAN2Homo sapiens (Human)9606337

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A2I3RGR9

Checksumi: 8C14AF540F3150CF

FASTA33738,003
        10         20         30         40         50
MESGSTAASE EARSLRECEL YVQKHNIQAL LKDSIVQLCT ARPERPMAFL
60 70 80 90 100
REYFERLEKE EAKQIQNLQK AGTRTDSRED EISPPPPNPV VKGRRRRGAI
110 120 130 140 150
SAEVYTEEDA ASYVRKVIPK DYKTMAALAK AIEKNVLFSH LDDNERSDIF
160 170 180 190 200
DAMFSVSFIA GETVIQQGDE GDNFYVIDQG ETDVYVNNEW ATSVGEGGSF
210 220 230 240 250
GELALIYGTP RAATVKAKTN VKLWGIDRDS YRRILMGSTL RKRKMYEEFL
260 270 280 290 300
SKVSILESLD KWERLTVADA LEPVQFEDGQ KIVVQGEPGD EFFIILEGSA
310 320 330
AVLQRRSENE EFVEVGRLGP SDYFGHLIIS RRSIPLG
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again