Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_A0A2I3S647 EXOSC2 isoform 6 n=5 Tax=Hominoidea TaxID=314295 RepID=A0A2I3S647_PANTR MAMEMRLPVARKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSV ERVNKLICVKALKTRYIGEVGDIVVGRITERRRSAEDELAMRGFLQEGDLISAEVQAVFS DGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIYPTPE HKEEEAGGFIANLEPVSLADREVISRLRNCIISLVTQRMMLYDTSILYCYEASLPHQIKD ILKPEIMEEIVMETRQRLLEQEG

Members

Expand cluster to 90% or 50% identity.
1 to 5 of 5  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A2I3S647A0A2I3S647_PANTREXOSC2 isoform 6Pan troglodytes (Chimpanzee)9598263Representative & Seed
A0A2J8UJF5A0A2J8UJF5_PONABEXOSC2 isoform 6Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601263
A0A2R9B7J6A0A2R9B7J6_PANPAUncharacterized proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597263
A0A2I3HJU2A0A2I3HJU2_NOMLEUncharacterized proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853263
Q13868-3Isoform 3 of EXOS2_HUMAN3Homo sapiens (Human)9606263

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A2I3S647

Checksumi: AB9C1DDC75EB79D1

FASTA26329,408
        10         20         30         40         50
MAMEMRLPVA RKPLSERLGR DTKKHLVVPG DTITTDTGFM RGHGTYMGEE
60 70 80 90 100
KLIASVAGSV ERVNKLICVK ALKTRYIGEV GDIVVGRITE RRRSAEDELA
110 120 130 140 150
MRGFLQEGDL ISAEVQAVFS DGAVSLHTRS LKYGKLGQGV LVQVSPSLVK
160 170 180 190 200
RQKTHFHDLP CGASVILGNN GFIWIYPTPE HKEEEAGGFI ANLEPVSLAD
210 220 230 240 250
REVISRLRNC IISLVTQRMM LYDTSILYCY EASLPHQIKD ILKPEIMEEI
260
VMETRQRLLE QEG
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again