Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_A0A2I3S9X7 CXADR isoform 1 n=3 Tax=Homininae TaxID=207598 RepID=A0A2I3S9X7_PANTR MALLLCFVLLCGVVDFARSLSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLIS PADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQC KVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKIKCEPKEGSLPLQYEWQKLSD SQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNKAGLIA GAIIGTLLALALIGLIIFCCRKKRREEKYEKEVHHDIREDVPPPKSRTSTARSYIGSNHS SLGSMSPSNMEGYSKTQYNQVPSEDFERTPQSPTLPPAKFKYPYKTDGITVV

Members

Expand cluster to 90% or 50% identity.
1 to 3 of 3  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A2I3S9X7A0A2I3S9X7_PANTRCXADR isoform 1Pan troglodytes (Chimpanzee)9598352Representative & Seed
P78310-6Isoform 6 of CXAR_HUMAN6Homo sapiens (Human)9606352
P78310-2Isoform 2 of CXAR_HUMAN2, CAR2, HCAR2, TVVHomo sapiens (Human)9606344

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A2I3S9X7

Checksumi: 0D7C56FEBE6BD653

FASTA35238,938
        10         20         30         40         50
MALLLCFVLL CGVVDFARSL SITTPEEMIE KAKGETAYLP CKFTLSPEDQ
60 70 80 90 100
GPLDIEWLIS PADNQKVDQV IILYSGDKIY DDYYPDLKGR VHFTSNDLKS
110 120 130 140 150
GDASINVTNL QLSDIGTYQC KVKKAPGVAN KKIHLVVLVK PSGARCYVDG
160 170 180 190 200
SEEIGSDFKI KCEPKEGSLP LQYEWQKLSD SQKMPTSWLA EMTSSVISVK
210 220 230 240 250
NASSEYSGTY SCTVRNRVGS DQCLLRLNVV PPSNKAGLIA GAIIGTLLAL
260 270 280 290 300
ALIGLIIFCC RKKRREEKYE KEVHHDIRED VPPPKSRTST ARSYIGSNHS
310 320 330 340 350
SLGSMSPSNM EGYSKTQYNQ VPSEDFERTP QSPTLPPAKF KYPYKTDGIT

VV
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again