Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_A0A2J8UX19 MEF2C isoform 12 n=14 Tax=Eutheria TaxID=9347 RepID=A0A2J8UX19_PONAB MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYAST DMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCDSPDPDADDSVGHSPESEDKYRKI NEDIDLMISRQRLCAVPPPNFEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRN SMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKS PPPMNLGMNNRKPDLRVLIPPGSKNTMPSVSEDVDLLLNQRINNSQSAQSLATPVVSVAT PTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGWQQQHLHNMPP SALSQLGDRTTTPSRYPQHTRHEAGRSPVDSLSSCSSSYDGSDREDHRNEFHSPIGLTRP SPDERESPSVKRMRLSEGWAT

Members

Expand cluster to 90% or 50% identity.
1 to 14 of 14  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A2J8UX19A0A2J8UX19_PONABMEF2C isoform 12Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601441Representative & Seed
A0A2J8NMR2A0A2J8NMR2_PANTRMEF2C isoform 15Pan troglodytes (Chimpanzee)9598441
A0A2K6SAW3A0A2K6SAW3_SAIBBMyocyte enhancer factor 2CSaimiri boliviensis boliviensis (Bolivian squirrel monkey)39432441
H9FUJ7H9FUJ7_MACMUMyocyte-specific enhancer factor 2C isoform 1Macaca mulatta (Rhesus macaque)9544441
A0A3Q7T1G2A0A3Q7T1G2_VULVUmyocyte-specific enhancer factor 2C isoform X3Vulpes vulpes (Red fox)9627441
A0A2I3M740A0A2I3M740_PAPANMADS-box domain-containing proteinPapio anubis (Olive baboon)9555441
F6RMR8F6RMR8_HORSEMyocyte enhancer factor 2CEquus caballus (Horse)9796441
G3U7G0G3U7G0_LOXAFMyocyte enhancer factor 2CLoxodonta africana (African elephant)9785441
A0A485MF44A0A485MF44_LYNPAMads box transcription enhancer factorLynx pardinus (Iberian lynx) (Felis pardina)191816441
A0A2U3ZJM6A0A2U3ZJM6_ODOROmyocyte-specific enhancer factor 2C isoform X5Odobenus rosmarus divergens (Pacific walrus)9708441
A0A3Q0EJH0A0A3Q0EJH0_TARSYmyocyte-specific enhancer factor 2C isoform X5Tarsius syrichta (Philippine tarsier)1868482441
I3LZD7I3LZD7_ICTTRMADS-box domain-containing proteinIctidomys tridecemlineatus (Thirteen-lined ground squirrel) (Spermophilus tridecemlineatus)43179441
Q06413-3Isoform 3 of MEF2C_HUMAN3, hMEF2C-delta32, BrainHomo sapiens (Human)9606441
UPI0004D06EB1myocyte-specific enhancer factor 2C isoform X4Galeopterus variegatus (Malayan flying lemur) (Cynocephalus variegatus)482537380

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A2J8UX19

Checksumi: BF94FD79A54FEEB1

FASTA44147,872
        10         20         30         40         50
MGRKKIQITR IMDERNRQVT FTKRKFGLMK KAYELSVLCD CEIALIIFNS
60 70 80 90 100
TNKLFQYAST DMDKVLLKYT EYNEPHESRT NSDIVETLRK KGLNGCDSPD
110 120 130 140 150
PDADDSVGHS PESEDKYRKI NEDIDLMISR QRLCAVPPPN FEMPVSIPVS
160 170 180 190 200
SHNSLVYSNP VSSLGNPNLL PLAHPSLQRN SMSPGVTHRP PSAGNTGGLM
210 220 230 240 250
GGDLTSGAGT SAGNGYGNPR NSPGLLVSPG NLNKNMQAKS PPPMNLGMNN
260 270 280 290 300
RKPDLRVLIP PGSKNTMPSV SEDVDLLLNQ RINNSQSAQS LATPVVSVAT
310 320 330 340 350
PTLPGQGMGG YPSAISTTYG TEYSLSSADL SSLSGFNTAS ALHLGSVTGW
360 370 380 390 400
QQQHLHNMPP SALSQLGDRT TTPSRYPQHT RHEAGRSPVD SLSSCSSSYD
410 420 430 440
GSDREDHRNE FHSPIGLTRP SPDERESPSV KRMRLSEGWA T
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again