Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_A0A2J8VG96 MUC1 isoform 5 n=1 Tax=Pongo abelii TaxID=9601 RepID=A0A2J8VG96_PONAB MTPGTQSPFFLLLLLTVLTATTASKPTTVVTGSGHASSTPGGEKETSATQRSSMPSSTEK NAFNSSLEDPSTNYYQELQRDISELSGAGVPGWGIALLVLVCVLVALAVVYLIALAVCQC RRKNYGQLDIFPARDAYHPMSEYPTYHTHGRYVPPSSTNHSPYEKVSAGNGGSSLSYTNP AVAATSANL

Members

Expand cluster to 90% or 50% identity.
1 to 1 of 1  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A2J8VG96A0A2J8VG96_PONABMUC1 isoform 5Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601189Representative & Seed

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A2J8VG96

Checksumi: FB9A94134ED1C915

FASTA18920,005
        10         20         30         40         50
MTPGTQSPFF LLLLLTVLTA TTASKPTTVV TGSGHASSTP GGEKETSATQ
60 70 80 90 100
RSSMPSSTEK NAFNSSLEDP STNYYQELQR DISELSGAGV PGWGIALLVL
110 120 130 140 150
VCVLVALAVV YLIALAVCQC RRKNYGQLDI FPARDAYHPM SEYPTYHTHG
160 170 180
RYVPPSSTNH SPYEKVSAGN GGSSLSYTNP AVAATSANL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again