Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_A0A2K5E4M9 Uncharacterized protein n=2 Tax=Aotus nancymaae TaxID=37293 RepID=A0A2K5E4M9_AOTNA MNTAPSRPSPTRRDPYGFGDSRDSRRDRSPIRGSPRREPRDGRNGRDARDSRDIRDPRDL RDHRHSRDLRDHRDSRSMRDVRDMRDLRDFRDLRDSRDFRDQRDPMYDRYRDMRDSRDPV YRREGSYDRYLRMDDYCRRKDDSYFDRYRDSFDGRGPPGPESQSRAKERLKREERRREEL YRQYFEEIQRRFDAERPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTEVSLSQ ALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNE CREKEREEIARQAAKMADEAILQERERGGPEEGVRGGHPPAIQSLINLLADNRYLTAEET DKIINYLRERKERLMRSSTDSLPGPISRQPLGATSGASLKTQPSSQPLQSGQVLPSATPT PSAPPTSQQELQAKILSLFNSGTVAANSSSTSPSVAAGNTPNQNFSTAANSQPQQRSQAS GNQPPSILGQGGSAQNMGPRPGAPSQGLFGQPSSRLAPASNMASQRPVSSTGINFDNPSV QKALDTLIQSGPALSHLVSQTTAQMGQPQAPMGSYQRHY

Members

Expand cluster to 90% or 50% identity.
1 to 2 of 2  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A2K5E4M9A0A2K5E4M9_AOTNAUncharacterized proteinAotus nancymaae (Ma's night monkey)37293579Representative & Seed
UPI0006251078nuclear receptor coactivator 5 isoform X2Aotus nancymaae (Ma's night monkey)37293502

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A2K5E4M9

Checksumi: EEF3F3280A4EC0CE

FASTA57965,538
        10         20         30         40         50
MNTAPSRPSP TRRDPYGFGD SRDSRRDRSP IRGSPRREPR DGRNGRDARD
60 70 80 90 100
SRDIRDPRDL RDHRHSRDLR DHRDSRSMRD VRDMRDLRDF RDLRDSRDFR
110 120 130 140 150
DQRDPMYDRY RDMRDSRDPV YRREGSYDRY LRMDDYCRRK DDSYFDRYRD
160 170 180 190 200
SFDGRGPPGP ESQSRAKERL KREERRREEL YRQYFEEIQR RFDAERPVDC
210 220 230 240 250
SVIVVNKQTK DYAESVGRKV RDLGMVVDLI FLNTEVSLSQ ALEDVSRGGS
260 270 280 290 300
PFAIVITQQH QIHRSCTVNI MFGTPQEHRN MPQADAMVLV ARNYERYKNE
310 320 330 340 350
CREKEREEIA RQAAKMADEA ILQERERGGP EEGVRGGHPP AIQSLINLLA
360 370 380 390 400
DNRYLTAEET DKIINYLRER KERLMRSSTD SLPGPISRQP LGATSGASLK
410 420 430 440 450
TQPSSQPLQS GQVLPSATPT PSAPPTSQQE LQAKILSLFN SGTVAANSSS
460 470 480 490 500
TSPSVAAGNT PNQNFSTAAN SQPQQRSQAS GNQPPSILGQ GGSAQNMGPR
510 520 530 540 550
PGAPSQGLFG QPSSRLAPAS NMASQRPVSS TGINFDNPSV QKALDTLIQS
560 570
GPALSHLVSQ TTAQMGQPQA PMGSYQRHY
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again