Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_A0A2K5HN48 SH3 domain-containing protein n=1 Tax=Colobus angolensis palliatus TaxID=336983 RepID=A0A2K5HN48_COLAP MGEITIGKKLPATAATPDSSKTEMDSRTKSKDYCKVIFPYEAQNDDELTIKEGDIVTLIN KDCIDVGWWEGELNGRRGVFPDNFVKLLPPDFEKEGNRPKKPPPPSAPVVKQGAGTTERK HEIKKIPPERPEMLPNRTEEKERPEREPKLDLQKPSVPAIPPKKPRPPKTNSLSRPGALP PRRPERPVGPLTHTRGDGPKIDLAGSSLSGILDKDLSDRSNDIDLEGFDSVVSSTEKLSH PTTSRPKATGRRPPSQSLTSSSLSSPDIFDSPSPEEDKEEHISLAHRGVDASKKTSKTVT ISQVSDNKASLPPKPGTMAAGGGGPAPLSSAVPSPLSSSLGTAGHRANSPSLFGTEGKPK MEPAASSQAAVEELRTQVRELRSIIETMKDQQKREIKQLLSELDEEKKIRLRLQMEVNDI KKVLQSK

Members

Expand cluster to 90% or 50% identity.
1 to 1 of 1  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A2K5HN48A0A2K5HN48_COLAPSH3 domain-containing proteinColobus angolensis palliatus (Peters' Angolan colobus)336983427Representative & Seed

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A2K5HN48

Checksumi: 96FF2B0DFB648A4C

FASTA42746,576
        10         20         30         40         50
MGEITIGKKL PATAATPDSS KTEMDSRTKS KDYCKVIFPY EAQNDDELTI
60 70 80 90 100
KEGDIVTLIN KDCIDVGWWE GELNGRRGVF PDNFVKLLPP DFEKEGNRPK
110 120 130 140 150
KPPPPSAPVV KQGAGTTERK HEIKKIPPER PEMLPNRTEE KERPEREPKL
160 170 180 190 200
DLQKPSVPAI PPKKPRPPKT NSLSRPGALP PRRPERPVGP LTHTRGDGPK
210 220 230 240 250
IDLAGSSLSG ILDKDLSDRS NDIDLEGFDS VVSSTEKLSH PTTSRPKATG
260 270 280 290 300
RRPPSQSLTS SSLSSPDIFD SPSPEEDKEE HISLAHRGVD ASKKTSKTVT
310 320 330 340 350
ISQVSDNKAS LPPKPGTMAA GGGGPAPLSS AVPSPLSSSL GTAGHRANSP
360 370 380 390 400
SLFGTEGKPK MEPAASSQAA VEELRTQVRE LRSIIETMKD QQKREIKQLL
410 420
SELDEEKKIR LRLQMEVNDI KKVLQSK
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again