Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_A0A2K5IS91 Protein kinase domain-containing protein n=1 Tax=Colobus angolensis palliatus TaxID=336983 RepID=A0A2K5IS91_COLAP PLGGPGLGQPLGPHPGPWVTMLSPHPAWDGGRGAALIVRDQTELRLCERSGQRTASVLWP WINRNARVADLVHILTHLQLLRARDIITAWHPPAPLPSPSTTAPRPSSIPAPPEAEAWSP RKLPSSASTLLSPAFPGSQSHSGPELGLVPSPASLRPPPPSPAPSSTKVGPESSVSLLQG AHPSPFCWPLYEISQGTHNFSEELKIGEGGFGCVYRAVMRNTVYAVKRLKEDADLEWTAV KQSFLTEVEQLSRFRHPNIVDFAGYCAQNGFYCLVYGFLPNGSLEDRLHCQTQACPPLSW PQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDERLTPKLGDFGLARFSRFAGSSP SQSSTVARTRTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVVLETLAAQRAVKTHGARIK YLKDLVEEEAEEAGVALRSTQSTLQAGLAADSWAAPIAMQICKKHLDPRPGPCPPELGLG LGRLACCCLHRRAKRRPPMTQENSYVSSTGGAHSGAAPWQPLAAPSGASAQAVEQLQRGL NQPVESDESLGGLSAALRSWHLTPSCPLGPAPLGEASCPQGDTTGESSWGSGPGFRPTAV EGSWGDGFPGEGPGPPWTKASVVPTPAF

Members

Expand cluster to 90% or 50% identity.
1 to 1 of 1  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A2K5IS91A0A2K5IS91_COLAPProtein kinase domain-containing proteinColobus angolensis palliatus (Peters' Angolan colobus)336983628Representative & Seed

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A2K5IS91

Checksumi: 604212756310D33B

FASTA62867,025
        10         20         30         40         50
PLGGPGLGQP LGPHPGPWVT MLSPHPAWDG GRGAALIVRD QTELRLCERS
60 70 80 90 100
GQRTASVLWP WINRNARVAD LVHILTHLQL LRARDIITAW HPPAPLPSPS
110 120 130 140 150
TTAPRPSSIP APPEAEAWSP RKLPSSASTL LSPAFPGSQS HSGPELGLVP
160 170 180 190 200
SPASLRPPPP SPAPSSTKVG PESSVSLLQG AHPSPFCWPL YEISQGTHNF
210 220 230 240 250
SEELKIGEGG FGCVYRAVMR NTVYAVKRLK EDADLEWTAV KQSFLTEVEQ
260 270 280 290 300
LSRFRHPNIV DFAGYCAQNG FYCLVYGFLP NGSLEDRLHC QTQACPPLSW
310 320 330 340 350
PQRLDILLGT ARAIQFLHQD SPSLIHGDIK SSNVLLDERL TPKLGDFGLA
360 370 380 390 400
RFSRFAGSSP SQSSTVARTR TVRGTLAYLP EEYIKTGRLA VDTDTFSFGV
410 420 430 440 450
VVLETLAAQR AVKTHGARIK YLKDLVEEEA EEAGVALRST QSTLQAGLAA
460 470 480 490 500
DSWAAPIAMQ ICKKHLDPRP GPCPPELGLG LGRLACCCLH RRAKRRPPMT
510 520 530 540 550
QENSYVSSTG GAHSGAAPWQ PLAAPSGASA QAVEQLQRGL NQPVESDESL
560 570 580 590 600
GGLSAALRSW HLTPSCPLGP APLGEASCPQ GDTTGESSWG SGPGFRPTAV
610 620
EGSWGDGFPG EGPGPPWTKA SVVPTPAF
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again