Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_A0A2K6DSF0 Fe2OG dioxygenase domain-containing protein n=1 Tax=Macaca nemestrina TaxID=9545 RepID=A0A2K6DSF0_MACNE MEEKRRRARVQGAWAAPAKSQAIAQPATTAKSHLYQKPGQTWKNKEHHLSDREFVFKEPQ QVNSFCFLCFFSREGVYEISLSPTGVSRVCLYPGFVDVKEADWILEQLCQDVPWKQRTGI REDITYQQPRLTAWYGELPYTYSRITMEPNPHWHPVLRTLKNRIEENTGHTFNSLLCNLY RNEKDSVDWHSDDEPSLGRCPTIASLSFGATRIFEMRKKPPPEENGDYTYVERVKIPLDH GTLLIMEGATQADWQHRVPKEYHSRELRVNLTFRTVYPDPRRAPW

Members

Expand cluster to 90% or 50% identity.
1 to 1 of 1  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A2K6DSF0A0A2K6DSF0_MACNEFe2OG dioxygenase domain-containing proteinMacaca nemestrina (Pig-tailed macaque)9545285Representative & Seed

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A2K6DSF0

Checksumi: ADED5E4F7B9BBC3E

FASTA28533,395
        10         20         30         40         50
MEEKRRRARV QGAWAAPAKS QAIAQPATTA KSHLYQKPGQ TWKNKEHHLS
60 70 80 90 100
DREFVFKEPQ QVNSFCFLCF FSREGVYEIS LSPTGVSRVC LYPGFVDVKE
110 120 130 140 150
ADWILEQLCQ DVPWKQRTGI REDITYQQPR LTAWYGELPY TYSRITMEPN
160 170 180 190 200
PHWHPVLRTL KNRIEENTGH TFNSLLCNLY RNEKDSVDWH SDDEPSLGRC
210 220 230 240 250
PTIASLSFGA TRIFEMRKKP PPEENGDYTY VERVKIPLDH GTLLIMEGAT
260 270 280
QADWQHRVPK EYHSRELRVN LTFRTVYPDP RRAPW
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again