Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_A0A337SB91 SH3 domain-containing protein n=2 Tax=Felis catus TaxID=9685 RepID=A0A337SB91_FELCA MGEETIGKKLPPTTATPDSSKPEMDGRTKTKDYCKVIFPYEAQNDDELTIKEGDIVTLIN KDCIDVGWWEGELNGRRGVFPDNFVKLLPPDFEKEGNRPKKPPPPSAPVIKQGAGTTERK HEIKKIPPERPETLPNRTEEKERPEREPKLDLQKPSVPAIPPKKPRPPKTNSLSRPGALP PRRPERPVGPLTHSRGDGPKIDLVGSSISGILDKDLSDRSNDIDLEGFDSVVSSTEKLSH PTTSRPKATGRRPPSQSLTSSSLSSPDIFDSPSPEEDKEEHVSLAHRGVEASKKTSKTVT ISQVSDNKASLPPKPGTMAAGGGGGPASLSSATSSPLSSSLGTAGHRANSPSLFGSEGKP KTEPAASSQAAVEELRTQVRELRSIIETMKDQQKREIKQLLSELDEEKKIRLRLQMEVND IKKTLQSK

Members

Expand cluster to 90% or 50% identity.
1 to 2 of 2  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A337SB91A0A337SB91_FELCASH3 domain-containing proteinFelis catus (Cat) (Felis silvestris catus)9685428Representative
UPI000298D1F8SH3 domain-containing kinase-binding protein 1 isoform X9Felis catus (Cat) (Felis silvestris catus)9685429Seed

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A337SB91

Checksumi: 591C98C8D1223C3D

FASTA42846,623
        10         20         30         40         50
MGEETIGKKL PPTTATPDSS KPEMDGRTKT KDYCKVIFPY EAQNDDELTI
60 70 80 90 100
KEGDIVTLIN KDCIDVGWWE GELNGRRGVF PDNFVKLLPP DFEKEGNRPK
110 120 130 140 150
KPPPPSAPVI KQGAGTTERK HEIKKIPPER PETLPNRTEE KERPEREPKL
160 170 180 190 200
DLQKPSVPAI PPKKPRPPKT NSLSRPGALP PRRPERPVGP LTHSRGDGPK
210 220 230 240 250
IDLVGSSISG ILDKDLSDRS NDIDLEGFDS VVSSTEKLSH PTTSRPKATG
260 270 280 290 300
RRPPSQSLTS SSLSSPDIFD SPSPEEDKEE HVSLAHRGVE ASKKTSKTVT
310 320 330 340 350
ISQVSDNKAS LPPKPGTMAA GGGGGPASLS SATSSPLSSS LGTAGHRANS
360 370 380 390 400
PSLFGSEGKP KTEPAASSQA AVEELRTQVR ELRSIIETMK DQQKREIKQL
410 420
LSELDEEKKI RLRLQMEVND IKKTLQSK
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again