Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_A0A3B8DUU2 Transcription factor AbaA n=1 Tax=Purpureocillium lavendulum TaxID=1247861 RepID=A0A3B8DUU2_9HYPO MSSSLYQPRPVLSSQRYSQSPDYVDSRRGSSSNTAAAAAGSAVHHVPGRMPLRDTTGNAQ AHSFNGSIVACYQSPVTLSPSMQTNIPAPMVPSQSFDCLYRVPTPRQQPRYQRKPRHVNP LYYWPAFRQYRNRQAHKDTQKDKGGVWRRPELEDAFVDSVLLMPHMGRRKFSMGGKLHGR NMLISEYIFVICVALLGSKEIFRIDNSNESIEQMGRKQVSSHMQVVKKFFEDLRCFHFLF PSEEKKEPGSTNSDDYYDEEEQESFKSNPVLTALAEGRVPDVKPNYDYFSTLLALQSSIC VRPKTCEVFVSSSDIKIRDDVAYDAHDNPLDQNSFPHLNKYTNCDDSPNVLGKDVLLHEY TRSLDRTTSACVKSVTRRWQKDAPAMYETLDLPARDEECLLLEMCSTIELHEHAKFPSGS ELTGFVEVAITQPALQTHRWKCITRLTRPAELHSDDGKQGVYTNDSGIHRRGCSDSKNDC DCHTRPRADIHVPFPAVEWASILSMAVQYPDAEHQRMKEKRRRNADGDKKDVERAGSKRK RSEDEGDAASWARREPTGSDLICKVAMYQELWSCAPDSTQWTRQGIIFWRFNTTNQWHKY NPVFKPAGTTWRWLTINDPMSRYHQQKALVYPTAGVPRDAIMSPTPTINQHLTAAMNETF NAWDNGGSSSSNGSGGHHSHHHHHHHGAPHVPPLQTSSASLGLFDSFSGGLATPPPTATL PGAYSTSSSFDAGMSSNGGVSFLPSTTGSSDASDRQSTSLSSSQTYFDGGPSSFGDVKPM ANGVGPYMAGAGAGATTTTGGLDLPNQLVYDGSGCDAGNMQGWDMGALDGWTTATASGPP SATTEWGPTPKMEPQGGHHHHQHTHHAAAALWAPPQWPAMTAGAAPGSHERGGSPRPIKR RRDAIDSHVPVTAGW

Members

Expand cluster to 90% or 50% identity.
1 to 1 of 1  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A3B8DUU2A0A3B8DUU2_9HYPOTranscription factor AbaAPurpureocillium lavendulum1247861915Representative & Seed

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A3B8DUU2

Checksumi: C6F4AF9B31154D2E

FASTA915101,097
        10         20         30         40         50
MSSSLYQPRP VLSSQRYSQS PDYVDSRRGS SSNTAAAAAG SAVHHVPGRM
60 70 80 90 100
PLRDTTGNAQ AHSFNGSIVA CYQSPVTLSP SMQTNIPAPM VPSQSFDCLY
110 120 130 140 150
RVPTPRQQPR YQRKPRHVNP LYYWPAFRQY RNRQAHKDTQ KDKGGVWRRP
160 170 180 190 200
ELEDAFVDSV LLMPHMGRRK FSMGGKLHGR NMLISEYIFV ICVALLGSKE
210 220 230 240 250
IFRIDNSNES IEQMGRKQVS SHMQVVKKFF EDLRCFHFLF PSEEKKEPGS
260 270 280 290 300
TNSDDYYDEE EQESFKSNPV LTALAEGRVP DVKPNYDYFS TLLALQSSIC
310 320 330 340 350
VRPKTCEVFV SSSDIKIRDD VAYDAHDNPL DQNSFPHLNK YTNCDDSPNV
360 370 380 390 400
LGKDVLLHEY TRSLDRTTSA CVKSVTRRWQ KDAPAMYETL DLPARDEECL
410 420 430 440 450
LLEMCSTIEL HEHAKFPSGS ELTGFVEVAI TQPALQTHRW KCITRLTRPA
460 470 480 490 500
ELHSDDGKQG VYTNDSGIHR RGCSDSKNDC DCHTRPRADI HVPFPAVEWA
510 520 530 540 550
SILSMAVQYP DAEHQRMKEK RRRNADGDKK DVERAGSKRK RSEDEGDAAS
560 570 580 590 600
WARREPTGSD LICKVAMYQE LWSCAPDSTQ WTRQGIIFWR FNTTNQWHKY
610 620 630 640 650
NPVFKPAGTT WRWLTINDPM SRYHQQKALV YPTAGVPRDA IMSPTPTINQ
660 670 680 690 700
HLTAAMNETF NAWDNGGSSS SNGSGGHHSH HHHHHHGAPH VPPLQTSSAS
710 720 730 740 750
LGLFDSFSGG LATPPPTATL PGAYSTSSSF DAGMSSNGGV SFLPSTTGSS
760 770 780 790 800
DASDRQSTSL SSSQTYFDGG PSSFGDVKPM ANGVGPYMAG AGAGATTTTG
810 820 830 840 850
GLDLPNQLVY DGSGCDAGNM QGWDMGALDG WTTATASGPP SATTEWGPTP
860 870 880 890 900
KMEPQGGHHH HQHTHHAAAA LWAPPQWPAM TAGAAPGSHE RGGSPRPIKR
910
RRDAIDSHVP VTAGW
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again