Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_A0A452FX36 TNF alpha induced protein 8 n=2 Tax=Capra hircus TaxID=9925 RepID=A0A452FX36_CAPHI MSAVVAPAAAYPDTMHFEAEESKEVATDVFNSKNLAVQAQKKILGKMASKSIATTLIDDT SSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKV HQLAMTVVSFHQVDFTFDRNVLSKLLNECREMLHQVIQRHLTAKSHGRVNNVFDHFSDCD FLAALYNPFGNFKPHLQKLCDGINKMLDEENI

Members

Expand cluster to 90% or 50% identity.
1 to 2 of 2  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A452FX36A0A452FX36_CAPHITNF alpha induced protein 8Capra hircus (Goat)9925212Representative & Seed
UPI0008469E1Btumor necrosis factor alpha-induced protein 8 isoform X5Capra hircus (Goat)9925166

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A452FX36

Checksumi: F85DCF612D7ADB3E

FASTA21224,309
        10         20         30         40         50
MSAVVAPAAA YPDTMHFEAE ESKEVATDVF NSKNLAVQAQ KKILGKMASK
60 70 80 90 100
SIATTLIDDT SSEVLDELYR VTREYTQNKK EAEKIIKNLI KTVIKLAILY
110 120 130 140 150
RNNQFNQDEL ALMEKFKKKV HQLAMTVVSF HQVDFTFDRN VLSKLLNECR
160 170 180 190 200
EMLHQVIQRH LTAKSHGRVN NVFDHFSDCD FLAALYNPFG NFKPHLQKLC
210
DGINKMLDEE NI
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again