Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_A0A5E4AFV1 Uncharacterized protein n=2 Tax=Marmotini TaxID=337730 RepID=A0A5E4AFV1_MARMO MGARPSRRRLPVDPPVALDVLPPELLVQVLSHVPPRALVTRCRPVCRAWRDVVDGPTVWL LQLARDRSAEGRAFYALAQRCPPSDDDEEELPLCALARYCLRAPLGRNLIFNSCGEQGFR GWEVEHGGNGWAVEKNLTLVPGAPSQTCFVTSFEWCFKRQLVDLVMEGVWQELLDSAQIE ICVADWWGARENCGCIYRLRVRLLDMYENEVVKFSASPNPVLQWTERSCRQVSHVFTNFG KGIRYVSFEQYGRDMRSWVGHYGALVTHSSVRIRIRPS

Members

Expand cluster to 90% or 50% identity.
1 to 2 of 2  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A5E4AFV1A0A5E4AFV1_MARMOUncharacterized proteinMarmota monax (Woodchuck)9995278Representative & Seed
UPI000E55B294F-box only protein 17Urocitellus parryii (Arctic ground squirrel) (Spermophilus parryii)9999113

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A5E4AFV1

Checksumi: 18517D947D92AE13

FASTA27831,687
        10         20         30         40         50
MGARPSRRRL PVDPPVALDV LPPELLVQVL SHVPPRALVT RCRPVCRAWR
60 70 80 90 100
DVVDGPTVWL LQLARDRSAE GRAFYALAQR CPPSDDDEEE LPLCALARYC
110 120 130 140 150
LRAPLGRNLI FNSCGEQGFR GWEVEHGGNG WAVEKNLTLV PGAPSQTCFV
160 170 180 190 200
TSFEWCFKRQ LVDLVMEGVW QELLDSAQIE ICVADWWGAR ENCGCIYRLR
210 220 230 240 250
VRLLDMYENE VVKFSASPNP VLQWTERSCR QVSHVFTNFG KGIRYVSFEQ
260 270
YGRDMRSWVG HYGALVTHSS VRIRIRPS
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again