Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_A2RNF3 50S ribosomal protein L1 n=12 Tax=Lactococcus lactis TaxID=1358 RepID=RL1_LACLM MAKKSKALRAAIEKIDATKAYSVEEAVALAKETSFAKFDATVEVAYNLNIDVKKSDQQIR GAMVLPNGTGKTARVLVFAKGAKAEEATAAGADFVGSDELVAKINGGWLDFDVVIATPDM MAVVGRLGRVLGPRNLMPNPKTGTVTMDVTKAVGESKAGKVNYRADKAGNVHVPIGKVSF DTEKLVENFKALNTVIAAAKPAASKGAYITNLSVTTTMGPGVKVDSASF

Members

Expand cluster to 90% or 50% identity.
1 to 12 of 12  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A2RNF3RL1_LACLM50S ribosomal protein L1Lactococcus lactis subsp. cremoris (strain MG1363)416870229Representative & Seed
Q02WD3RL1_LACLS50S ribosomal protein L1Lactococcus lactis subsp. cremoris (strain SK11)272622229
A0A552XPK4A0A552XPK4_9LACT50S ribosomal protein L1Lactococcus lactis1358229
T0S5K7T0S5K7_LACLC50S ribosomal protein L1Lactococcus lactis subsp. cremoris TIFN61234876229
A0A0M2ZPA6A0A0M2ZPA6_LACLC50S ribosomal protein L1Lactococcus lactis subsp. cremoris (Streptococcus cremoris)1359229
T0UY81T0UY81_LACLC50S ribosomal protein L1Lactococcus lactis subsp. cremoris TIFN11234871229
T2F918T2F918_LACLC50S ribosomal protein L1Lactococcus lactis subsp. cremoris KW21295826229
T0WMQ5T0WMQ5_LACLC50S ribosomal protein L1Lactococcus lactis subsp. cremoris TIFN31234873229
A0A1E7G1R5A0A1E7G1R5_LACLC50S ribosomal protein L1Lactococcus lactis subsp. cremoris IBB4771449093229
A0A084ADT3A0A084ADT3_LACLC50S ribosomal protein L1Lactococcus lactis subsp. cremoris GE2141415168229
T0UI96T0UI96_LACLC50S ribosomal protein L1Lactococcus lactis subsp. cremoris TIFN71234877229
G8P988G8P988_LACLC50S ribosomal protein L1Lactococcus lactis subsp. cremoris A761104322229

Sequence

Representative sequenceiLengthMass (Da)Tools
A2RNF3

Checksumi: E76B04C565EC5670

FASTA22923,950
        10         20         30         40         50
MAKKSKALRA AIEKIDATKA YSVEEAVALA KETSFAKFDA TVEVAYNLNI
60 70 80 90 100
DVKKSDQQIR GAMVLPNGTG KTARVLVFAK GAKAEEATAA GADFVGSDEL
110 120 130 140 150
VAKINGGWLD FDVVIATPDM MAVVGRLGRV LGPRNLMPNP KTGTVTMDVT
160 170 180 190 200
KAVGESKAGK VNYRADKAGN VHVPIGKVSF DTEKLVENFK ALNTVIAAAK
210 220
PAASKGAYIT NLSVTTTMGP GVKVDSASF
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again