Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_A5PKH8 PGM2L1 protein n=2 Tax=Bos TaxID=9903 RepID=A5PKH8_BOVIN MTENAEGDLNSNLLHAPYHTGDPQLDTAIGQWLRWDKNPKTKEQIENLLRNGMNKELRDR LCCRMTFGTAGLRSAMGAGFCYINDLTVIQSTQGMYKYLERCFSDFKQRGFVVGYDTRGQ VTSSCSSQRLAKLTAAVLLAKDVPVYLFSRYVPTPFVPYAVQELKAVAGVMITASHNRKE DNGYKVYWENGAQITSPHDKEILKCIEECVEPWNGSWNDNLVDTSPLKRDPLQDICRRYM DDLKKICFYRELNSKTTLKFVHTSFHGVGHDYVQLAFQVFGFKPPIPVPEQKDPDPDFST VKCPNPEEGESVLELSLRLAEKENARIVLATDPDADRLAVAELQENGVWKVFTGNELAAL FGWWMFDCWKKSKSRNADVNNIYMLATTVSSKILKAIALKEGFHFEETLPGFKWIGSRIK DLLENGKEVLFSFEESIGFLCGTSVLDKDGVSAAVVVAEMASYLETMNITLKQQLINVYE KYGYHISKTSYFLCYDPTTIKSIFERLRNFDSPKEYPKFCGAFAILHVRDITTGYDSSQP NKKSVLPVSKSSQMITFTFQNGCVATLRTSGTEPKIKYYAEMCASPDQSDTALLEEELKK LIDALIENFLEPSKNGLTWRSV

Members

Expand cluster to 90% or 50% identity.
1 to 2 of 2  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A5PKH8A5PKH8_BOVINPGM2L1 proteinBos taurus (Bovine)9913622Representative
A0A4W2IH23A0A4W2IH23_BOBOXUncharacterized proteinBos indicus x Bos taurus (Hybrid cattle)30522622Seed

Sequence

Representative sequenceiLengthMass (Da)Tools
A5PKH8

Checksumi: 533435FD41391BD8

FASTA62270,419
        10         20         30         40         50
MTENAEGDLN SNLLHAPYHT GDPQLDTAIG QWLRWDKNPK TKEQIENLLR
60 70 80 90 100
NGMNKELRDR LCCRMTFGTA GLRSAMGAGF CYINDLTVIQ STQGMYKYLE
110 120 130 140 150
RCFSDFKQRG FVVGYDTRGQ VTSSCSSQRL AKLTAAVLLA KDVPVYLFSR
160 170 180 190 200
YVPTPFVPYA VQELKAVAGV MITASHNRKE DNGYKVYWEN GAQITSPHDK
210 220 230 240 250
EILKCIEECV EPWNGSWNDN LVDTSPLKRD PLQDICRRYM DDLKKICFYR
260 270 280 290 300
ELNSKTTLKF VHTSFHGVGH DYVQLAFQVF GFKPPIPVPE QKDPDPDFST
310 320 330 340 350
VKCPNPEEGE SVLELSLRLA EKENARIVLA TDPDADRLAV AELQENGVWK
360 370 380 390 400
VFTGNELAAL FGWWMFDCWK KSKSRNADVN NIYMLATTVS SKILKAIALK
410 420 430 440 450
EGFHFEETLP GFKWIGSRIK DLLENGKEVL FSFEESIGFL CGTSVLDKDG
460 470 480 490 500
VSAAVVVAEM ASYLETMNIT LKQQLINVYE KYGYHISKTS YFLCYDPTTI
510 520 530 540 550
KSIFERLRNF DSPKEYPKFC GAFAILHVRD ITTGYDSSQP NKKSVLPVSK
560 570 580 590 600
SSQMITFTFQ NGCVATLRTS GTEPKIKYYA EMCASPDQSD TALLEEELKK
610 620
LIDALIENFL EPSKNGLTWR SV
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again