Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_A6ZIE4 MUC1 isoform M10 n=1 Tax=Homo sapiens TaxID=9606 RepID=A6ZIE4_HUMAN MTPGTQSPFFLLLLLTVLTATTAPKPATVVTGSGHASSTPGGEKETSATQRSSVPSSTEK NAFNSSLEDPSTDYYQELQRDISEMSGAGVPGWGIALLVLVCVLVALAIVYLIALAVCQC RRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNP AVAATSANL

Members

Expand cluster to 90% or 50% identity.
1 to 1 of 1  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A6ZIE4A6ZIE4_HUMANMUC1 isoform M10Homo sapiens (Human)9606189Representative & Seed

Sequence

Representative sequenceiLengthMass (Da)Tools
A6ZIE4

Checksumi: C617B22043CAD95A

FASTA18920,037
        10         20         30         40         50
MTPGTQSPFF LLLLLTVLTA TTAPKPATVV TGSGHASSTP GGEKETSATQ
60 70 80 90 100
RSSVPSSTEK NAFNSSLEDP STDYYQELQR DISEMSGAGV PGWGIALLVL
110 120 130 140 150
VCVLVALAIV YLIALAVCQC RRKNYGQLDI FPARDTYHPM SEYPTYHTHG
160 170 180
RYVPPSSTDR SPYEKVSAGN GGSSLSYTNP AVAATSANL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again