Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_A6ZLF7 Ubiquitin-like protein ATG12 n=8 Tax=Saccharomyces TaxID=4930 RepID=ATG12_YEAS7 MSRILESENETESDESSIISTNNGTAMERSRNNQELRSSPHTVQNRLELFSRRLSQLGLA SDISVDQQVEDSSSGTYEQEETIKTNAQTSKQKSHKDEKNIQKIQIKFQPIGSIGQLKPS VCKISMSQSFAMVILFLKRRLKMDHVYCYINNSFAPSPQQNIGELWMQFKTNDELIVSYC ASVAFG

Members

Expand cluster to 90% or 50% identity.
1 to 8 of 8  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A6ZLF7ATG12_YEAS7Ubiquitin-like protein ATG12Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)307796186Representative & Seed
P38316ATG12_YEASTUbiquitin-like protein ATG12Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)559292186
A0A0L8VUV4A0A0L8VUV4_9SACHUbiquitin-like protein ATG12Saccharomyces sp. 'boulardii'252598186
D3UEW3D3UEW3_YEAS8Ubiquitin-like protein ATG12Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) (Baker's yeast)643680186
H0GCR8H0GCR8_SACCKUbiquitin-like protein ATG12Saccharomyces cerevisiae x Saccharomyces kudriavzevii (strain VIN7) (Yeast)1095631186
N1PAV3N1PAV3_YEASCUbiquitin-like protein ATG12Saccharomyces cerevisiae (strain CEN.PK113-7D) (Baker's yeast)889517186
C7GUY9C7GUY9_YEAS2Ubiquitin-like protein ATG12Saccharomyces cerevisiae (strain JAY291) (Baker's yeast)574961186
B3LMU3B3LMU3_YEAS1Ubiquitin-like protein ATG12Saccharomyces cerevisiae (strain RM11-1a) (Baker's yeast)285006186

Sequence

Representative sequenceiLengthMass (Da)Tools
A6ZLF7

Checksumi: 74B3C9FD3CEA9265

FASTA18621,106
        10         20         30         40         50
MSRILESENE TESDESSIIS TNNGTAMERS RNNQELRSSP HTVQNRLELF
60 70 80 90 100
SRRLSQLGLA SDISVDQQVE DSSSGTYEQE ETIKTNAQTS KQKSHKDEKN
110 120 130 140 150
IQKIQIKFQP IGSIGQLKPS VCKISMSQSF AMVILFLKRR LKMDHVYCYI
160 170 180
NNSFAPSPQQ NIGELWMQFK TNDELIVSYC ASVAFG
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again