Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_A7ZM99 Tyrosine--tRNA ligase n=173 Tax=Bacteria TaxID=2 RepID=SYY_ECO24 MASSNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSLHLGHLVPLLCLKR FQQAGHKPVALVGGATGLIGDPSFKAAERKLNTEETVQEWVDKIRKQVAPFLDFDCGENS AIAANNYDWFGNMNVLTFLRDIGKHFSVNQMINKEAVKQRLNREDQGISFTEFSYNLLQG YDFACLNKQYGVVLQIGGSDQWGNITSGIDLTRRLHQNQVFGLTVPLITKADGTKFGKTE GGAVWLDPKKTSPYKFYQFWINTADADVYRFLKFFTFMSIEEINALEEEDKNSGKAPRAQ YVLAEQVTRLVHGEEGLQAAKRITECLFSGSLSALSEADFEQLAQDGVPMVEMEKGADLM QALVDSELQPSRGQARKTIASNAITINGEKQSDPEYFFKEEDRLFGRFTLLRRGKKNYCL ICWK

Members

Expand cluster to 90% or 50% identity.
1 to 25 of 173  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A7ZM99SYY_ECO24Tyrosine--tRNA ligaseEscherichia coli O139:H28 (strain E24377A / ETEC)331111424Representative
P0AGK0SYY_ECO57Tyrosine--tRNA ligaseEscherichia coli O157:H783334424
B5Z471SYY_ECO5ETyrosine--tRNA ligaseEscherichia coli O157:H7 (strain EC4115 / EHEC)444450424
B7NTZ5SYY_ECO7ITyrosine--tRNA ligaseEscherichia coli O7:K1 (strain IAI39 / ExPEC)585057424
C4ZYA0SYY_ECOBWTyrosine--tRNA ligaseEscherichia coli (strain K12 / MC4100 / BW2952)595496424
B1XFU9SYY_ECODHTyrosine--tRNA ligaseEscherichia coli (strain K12 / DH10B)316385424
A8A0I0SYY_ECOHSTyrosine--tRNA ligaseEscherichia coli O9:H4 (strain HS)331112424
B1IQB7SYY_ECOLCTyrosine--tRNA ligaseEscherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)481805424
P0AGJ9SYY_ECOLITyrosine--tRNA ligaseEscherichia coli (strain K12)83333424
B7NB91SYY_ECOLUTyrosine--tRNA ligaseEscherichia coli O17:K52:H18 (strain UMN026 / ExPEC)585056424
B6IB76SYY_ECOSETyrosine--tRNA ligaseEscherichia coli (strain SE11)409438424
B1LEP9SYY_ECOSMTyrosine--tRNA ligaseEscherichia coli (strain SMS-3-5 / SECEC)439855424
B2U2D7SYY_SHIB3Tyrosine--tRNA ligaseShigella boydii serotype 18 (strain CDC 3083-94 / BS512)344609424
Q3Z1Z3SYY_SHISSTyrosine--tRNA ligaseShigella sonnei (strain Ss046)300269424
C3T8R7C3T8R7_ECOLXTyrosine--tRNA ligaseEscherichia coli562428Seed
U9YU02U9YU02_ECOLXTyrosine--tRNA ligaseEscherichia coli 1132901268976428
E6BE19E6BE19_ECOLXTyrosine--tRNA ligaseEscherichia coli MS 85-1679202428
D7XFP1D7XFP1_ECOLXTyrosine--tRNA ligaseEscherichia coli MS 198-1749549428
D7ZLI4D7ZLI4_ECOLXTyrosine--tRNA ligaseEscherichia coli MS 69-1749531428
W8ZRR9W8ZRR9_ECOLXTyrosine--tRNA ligaseEscherichia coli O25b:H4-ST131941322428
D7Y2L9D7Y2L9_ECOLXTyrosine--tRNA ligaseEscherichia coli MS 115-1749537428
D8E4D2D8E4D2_ECOLXTyrosine--tRNA ligaseEscherichia coli MS 119-7679206428
A0A192C718A0A192C718_ECOLXTyrosine--tRNA ligaseEscherichia coli O25b:H4941280428
A0A1X3JGB9A0A1X3JGB9_ECOLXTyrosine--tRNA ligaseEscherichia coli H386656397428
D6IAU9D6IAU9_ECOLXTyrosine--tRNA ligaseEscherichia coli B185550676428

Sequence

Representative sequenceiLengthMass (Da)Tools
A7ZM99

Checksumi: 98E7080D85B356A2

FASTA42447,527
        10         20         30         40         50
MASSNLIKQL QERGLVAQVT DEEALAERLA QGPIALYCGF DPTADSLHLG
60 70 80 90 100
HLVPLLCLKR FQQAGHKPVA LVGGATGLIG DPSFKAAERK LNTEETVQEW
110 120 130 140 150
VDKIRKQVAP FLDFDCGENS AIAANNYDWF GNMNVLTFLR DIGKHFSVNQ
160 170 180 190 200
MINKEAVKQR LNREDQGISF TEFSYNLLQG YDFACLNKQY GVVLQIGGSD
210 220 230 240 250
QWGNITSGID LTRRLHQNQV FGLTVPLITK ADGTKFGKTE GGAVWLDPKK
260 270 280 290 300
TSPYKFYQFW INTADADVYR FLKFFTFMSI EEINALEEED KNSGKAPRAQ
310 320 330 340 350
YVLAEQVTRL VHGEEGLQAA KRITECLFSG SLSALSEADF EQLAQDGVPM
360 370 380 390 400
VEMEKGADLM QALVDSELQP SRGQARKTIA SNAITINGEK QSDPEYFFKE
410 420
EDRLFGRFTL LRRGKKNYCL ICWK
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again