Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_B0B7N4 50S ribosomal protein L1 n=2 Tax=Chlamydia trachomatis TaxID=813 RepID=RL1_CHLT2 MTKHGKRIRGIQETYDLAKSYSLGEAIDILKQCPTVRFDQTVDVSVKLGIDPRKSDQQIR GSVSLPHGTGKVLRILVFAAGDKAAEAIEAGADFVGSDDLVEKIKGGWVDFDVAVATPDM MREVGKLGKVLGPRNLMPTPKAGTVTTDVVKTIAELRKGKIEFKADRAGVCNVGVAKLSF DSAQIKENVEALCAALVKAKPATAKGQYLVNFTISSTMGPGVTVDTRELIAL

Members

Expand cluster to 90% or 50% identity.
1 to 2 of 2  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
B0B7N4RL1_CHLT250S ribosomal protein L1Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B)471472232Representative & Seed
A0A0E9C6Z4A0A0E9C6Z4_CHLTH50S ribosomal protein L1Chlamydia trachomatis813232

Sequence

Representative sequenceiLengthMass (Da)Tools
B0B7N4

Checksumi: 4508FEA1F55DDDE6

FASTA23224,742
        10         20         30         40         50
MTKHGKRIRG IQETYDLAKS YSLGEAIDIL KQCPTVRFDQ TVDVSVKLGI
60 70 80 90 100
DPRKSDQQIR GSVSLPHGTG KVLRILVFAA GDKAAEAIEA GADFVGSDDL
110 120 130 140 150
VEKIKGGWVD FDVAVATPDM MREVGKLGKV LGPRNLMPTP KAGTVTTDVV
160 170 180 190 200
KTIAELRKGK IEFKADRAGV CNVGVAKLSF DSAQIKENVE ALCAALVKAK
210 220 230
PATAKGQYLV NFTISSTMGP GVTVDTRELI AL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again