Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_B0TT23 50S ribosomal protein L20 n=2 Tax=Shewanella TaxID=22 RepID=RL20_SHEHH MPRVKRGVTARARHKKVLKLAKGYYGARSRTYRVAVQAVTKAGQYAYRDRRQKKRQFRQL WIARINAASRQNGLSYSRFINGLKKASIEIDRKILADIAVFDKVVFATLVEKAKDALAK

Members

Expand cluster to 90% or 50% identity.
1 to 2 of 2  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
B0TT23RL20_SHEHH50S ribosomal protein L20Shewanella halifaxensis (strain HAW-EB4)458817119Representative & Seed
A8H4U3RL20_SHEPA50S ribosomal protein L20Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)398579119

Sequence

Representative sequenceiLengthMass (Da)Tools
B0TT23

Checksumi: A824BA027FA19B69

FASTA11913,654
        10         20         30         40         50
MPRVKRGVTA RARHKKVLKL AKGYYGARSR TYRVAVQAVT KAGQYAYRDR
60 70 80 90 100
RQKKRQFRQL WIARINAASR QNGLSYSRFI NGLKKASIEI DRKILADIAV
110
FDKVVFATLV EKAKDALAK
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again