Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_B0XMP7 Probable beta-galactosidase A n=1 Tax=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) TaxID=451804 RepID=BGALA_ASPFC MKLLSVCAIALLAAQAAGASIKHMLNGFTLMEHSDPAKRELLQKYVTWDEKSLFVNGERI MIFSGEVHPFRLPVPSLWLDVFQKIKALGFNCVSFYVDWALLEGKPGEYRAEGNFALEPF FDVAKQAGIYLLARPGPYINAEASGGGFPGWLQRVNGTLRTSDPAYLKATDNYIAHVAAT IAKGQITNGGPVILYQPENEYSGACCDATFPDGDYMQYVIDQARNAGIVVPLINNDAWTG GHNAPGTGKGEVDIYGHDSYPLGFDCGHPSVWPKGNLPTTFRTDHLKQSPTTPYSLIEFQ AGSFDPWGGPGFAACAALVNHEFERVFYKNDLSFGAAILNLYMTFGGTNWGNLGHPGGYT SYDYGSPLTESRNVTREKYSELKLIGNFVKASPSYLLATPGNLTTSGYADTADLTVTPLL GNGTGSYFVVRHTDYTSQASTPYKLSLPTSAGRLTVPQLGGTLTLNGRDSKIHVVDYNVA GTNIIYSTAEVFTWKNFGDSKVLILYGGPGEHHELAVSFKSDVQVVEGSNSEFKSKKVGD VAVVAWDVSPSRRIVQIGDLKIFLLDRNSVYNYWVPQLDKDDSSTGYSSEKTTASSIIVK AGYLVRTAYTKGSGLYLTADFNATTPVEVIGAPSNVRNLYINGEKTQFKTDKNGIWSTEV KYSAPKIKLPSMKDLDWKYLDTLQEVQSTYDDSAWPAADLDTTPNTLRPLTTPKSLYSSD YGFHTGYLIYRGHFVADGSETTFDVRTQGGSAFGSSVWLNESFLGSWTGLNANADYNSTY KLPQVEQGKNYVLTILIDTMGLNENWVVGTDEMKNPRGILSYKLSGRDASAITWKLTGNL GGEDYQDKIRGPLNEGGLYAERQGFHQPQPPSQKWKSASPLDGLSKPGIGFYTAQFDLDI PSGWDVPLYFNFGNSTKSAYRVQLYVNGYQYGKFVSNIGPQTSFPVPQGILNYQGTNWVA LTLWALESDGAKLDDFELVNTTPVMTALSKIRPSKQPNYRQRKGAY

Members

Expand cluster to 90% or 50% identity.
1 to 1 of 1  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
B0XMP7BGALA_ASPFCProbable beta-galactosidase ANeosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) (Aspergillus fumigatus)4518041,006Representative & Seed

Sequence

Representative sequenceiLengthMass (Da)Tools
B0XMP7

Checksumi: 86CF2FDEF43A85BD

FASTA1,006110,405
        10         20         30         40         50
MKLLSVCAIA LLAAQAAGAS IKHMLNGFTL MEHSDPAKRE LLQKYVTWDE
60 70 80 90 100
KSLFVNGERI MIFSGEVHPF RLPVPSLWLD VFQKIKALGF NCVSFYVDWA
110 120 130 140 150
LLEGKPGEYR AEGNFALEPF FDVAKQAGIY LLARPGPYIN AEASGGGFPG
160 170 180 190 200
WLQRVNGTLR TSDPAYLKAT DNYIAHVAAT IAKGQITNGG PVILYQPENE
210 220 230 240 250
YSGACCDATF PDGDYMQYVI DQARNAGIVV PLINNDAWTG GHNAPGTGKG
260 270 280 290 300
EVDIYGHDSY PLGFDCGHPS VWPKGNLPTT FRTDHLKQSP TTPYSLIEFQ
310 320 330 340 350
AGSFDPWGGP GFAACAALVN HEFERVFYKN DLSFGAAILN LYMTFGGTNW
360 370 380 390 400
GNLGHPGGYT SYDYGSPLTE SRNVTREKYS ELKLIGNFVK ASPSYLLATP
410 420 430 440 450
GNLTTSGYAD TADLTVTPLL GNGTGSYFVV RHTDYTSQAS TPYKLSLPTS
460 470 480 490 500
AGRLTVPQLG GTLTLNGRDS KIHVVDYNVA GTNIIYSTAE VFTWKNFGDS
510 520 530 540 550
KVLILYGGPG EHHELAVSFK SDVQVVEGSN SEFKSKKVGD VAVVAWDVSP
560 570 580 590 600
SRRIVQIGDL KIFLLDRNSV YNYWVPQLDK DDSSTGYSSE KTTASSIIVK
610 620 630 640 650
AGYLVRTAYT KGSGLYLTAD FNATTPVEVI GAPSNVRNLY INGEKTQFKT
660 670 680 690 700
DKNGIWSTEV KYSAPKIKLP SMKDLDWKYL DTLQEVQSTY DDSAWPAADL
710 720 730 740 750
DTTPNTLRPL TTPKSLYSSD YGFHTGYLIY RGHFVADGSE TTFDVRTQGG
760 770 780 790 800
SAFGSSVWLN ESFLGSWTGL NANADYNSTY KLPQVEQGKN YVLTILIDTM
810 820 830 840 850
GLNENWVVGT DEMKNPRGIL SYKLSGRDAS AITWKLTGNL GGEDYQDKIR
860 870 880 890 900
GPLNEGGLYA ERQGFHQPQP PSQKWKSASP LDGLSKPGIG FYTAQFDLDI
910 920 930 940 950
PSGWDVPLYF NFGNSTKSAY RVQLYVNGYQ YGKFVSNIGP QTSFPVPQGI
960 970 980 990 1000
LNYQGTNWVA LTLWALESDG AKLDDFELVN TTPVMTALSK IRPSKQPNYR

QRKGAY
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again